Sorry, nothing was found. Please change your selection and try again.
Texturizing Spray
(81 - 120 of 258 results)
Filters
Best Match
Best Match
Price: Low to high
Price: High to low
"Living Proof Full Dry Volume & Texture Spray – Weightless Buildable Volume & Te
"Living Proof Full Dry Volume & Texture Spray – Weightless Buildable Volume & Te, Health & Beauty > Hair Care & Styling > Styling Products
£70.83
Shipping: Free
eBay - popular-products-uk
Mulac Volume Vibes - Volumizing and Texturizing Spray 150 Ml shopify_IT_14853409734980_53843159384388
VOLUME VIBES is a volumizing and texturizing spray. It volumizes and defines hair. Vegan and cruelty-free formula.
£25.00
Shipping: Free
OneBioShop
R+Co Halfpipe Dry Wax Texture Spray OPC-PHXQ75Z-NEW
This dry wax finishing spray features an ultra-fine mist that delivers a workable pliable texture that lifts hair with an invisible feel. It imparts...
£54.36
Shipping: Free
OnBuy
Goldwell Stylesign Heat Styling Blowout & Texture Spray - 200 ml shopify_IT_9522191925572_49112469274948
Perfectly voluminous hair thanks to styling spray | Give your hairstyle a voluminous effect wow with a full look and una texture. The hair spray Goldwell StyleSign Blowout & Texture Spray will become an invaluable tool for those seeking greater volume and definition. It will add vibrancy and energy to your hairstyle, resulting in airy, shiny hair that holds its shape just the way you want it.
£20.00
Shipping: Free
OneBioShop
Modern Pirate Sea Salt Hair Texture Spray - Black 7052781
Cool Water Sea Salt Spray is a product that helps to style hair into that messy, beachy look we all love. It gives hair textured waves and added volume due to the salt component in the spray.
£11.10
Shipping: Free
The Range
Maria nila Texture Spray - 250ml shopify_IT_15192730403140_55253737046340
The Maria Nila Texture Spray 250 ml is an innovative product ideal for chi who want to define and sculpt any hairstyle with ease. Enriched with natural ingredients and free from sulfates, parabens, and cruelty to animals, this spray guarantees una light and long-lasting hold without weighing down the hair. Its vegan formula gives volume and una matte texture, perfect for creating natural or more structured looks. Easy to distribute, it ensures a matte finish and una a sensation of soft hair to the touch. Suitable for all hair types, Maria Nila Texture Spray enhances your creativity by offering flexibility and control without compromising the care and respect for the hair fiber. A must-have for modern and sustainable hairstyles.
£40.00
Shipping: Free
OneBioShop
Rust-Oleum Textured Spray Paint - Desert Bisque 400ml AE0080002E8
Give your home or garden projects a fresh edge with Rust-Oleum Textured Spray Paint. Whether you want to transform dated furniture or breathe new life into tired metalwork, this spray paint delivers an instant upgrade with its unique multi-colour, tactile finish. Say goodbye to flat, boring surfaces and enjoy the convenience of a quick-drying formula that adheres beautifully and covers fast, indoors or out. Achieves a decorative, multi-coloured textured effect for an authentic look. Formulated for excellent coverage, so you can complete projects quickly and efficiently Suitable for use on wood and metal, can be used on other surfaces when paired with a Rust-Oleum primer Durable enough for both interior and exterior use, ensuring your results stand up to daily life and changing weather Available in four stylish finishes and a handy 400ml aerosol can, perfect for a wide range of upcycling and décor ideas
£14.00
Shipping: Free
Rust-Oleum
Living proof Full Dry Volume Texture Spray 99 fl oz OPC-PFRHNRB-NEW
Aversatiletexturizingspraythatturnsupthevolumeondifferentstylesforanimperfectlyperfectlivedinlookandfeel
£64.39
Shipping: Free
OnBuy
Toni & Guy Sea Salt Texture Spray, 200 ml B01BSPN7SC
CREATE BEACHY WAVES: Adds texture and separation to hair, helping you achieve tousled waves and effortless curls with a matte finish LIGHT HOLD & FLEXIBLE STYLING: Provides a soft, touchable hold that keeps waves in place without stiffness, crunch, or sticky residue ENHANCE HAIR BODY & MOVEMENT: Boosts volume and definition, giving hair a lived-in, textured look that still feels light and soft to the touch VERSATILE USE: Suitable for all hair types, works on damp or dry hair, and works well with other Toni & Guy Texture products for salon-quality results HOW TO USE: Shake well, spray evenly from roots to ends on dry or damp hair, then use fingers to scrunch and shape for long-lasting texture and waves
£5.50
Shipping: £4.49
Amazon
R&Co R+Co Zig Zag Root Tease + Texture Spray 177ml 78914573
R+Co Zig Zag Root Tease + Texture Spray 177ml, Health & Beauty > Hair Care & Styling > Styling Products
£52.16
Shipping: Free
eBay - your.essentials.store
Amika Un.Done Volume And Matte Texture Spray 150g 2035137
Amika Un.Done Volume And Matte Texture Spray 150g, Health & Beauty > Oral Care > Dental Floss & Flossers
£59.99
Shipping: £3.99
eBay - cookingm62
Shu Uemura Liquid Fabric Mineral Hair Texture Spray 250ml
Shu Uemura Liquid Fabric Mineral Hair Texture Spray 250ml, Health & Beauty > Hair Care & Styling > Styling Products
£28.99
Shipping: Free
eBay - jobber1919
Texturizing sea spray Sun Bum shopify_IT_14895226061124_54027095802180
Sun Bum Texturizing Sea Spray is a volume and styling spray for all hair types. For those few days when you're not at the beach but still want to look like one, you can use this texturizing spray with Hawaiian Sea Salt and Seaweed to achieve the desired result. This texturizing spray protects hair from the elements while also tempo Adds body, waves, and texture for a beachy, windswept look. The lightweight formula improves separation and definition, instantly blocking frizz-causing humidity. Texturizing Sea Spray gives hair the right texture and hold with a matte finish. Mahalo.
£43.00
Shipping: Free
OneBioShop
Unbranded 3500Ml Air Hopper Paint Texture Spray Tool Drywall Painting Sprayer with 6 Nozzles
Equipped with multiple nozzles of different caliber, easy to meet different needs Easy to install and connect with the air inlet, exquisite...
£51.53
Shipping: Free
OnBuy
Unbranded Texture Spray Gun with 1.45 Gallon Hopper, 3 Nozzles for Popcorn, Knockdown and Drywall Finishes
Professional Air Texture Spray Gun with Interchangeable Nozzles and LargeCapacity Hopper Achieve professionalquality wall and ceiling finishes...
£75.71
Shipping: Free
OnBuy
Sachajuan Ocean Mist - Volume and Texture Spray - 50ml shopify_IT_9754998833432_50257862820120
Ocean Mist by Sachajuan an innovative 50ml spray that gives hair instant volume and a natural texture, inspired by the freshness of the ocean. Formulated with Ocean Silk technology, enriched with nourishing ingredients, this product gives body and movement without weighing it down, ideal for those who want a lived-in but well-groomed look. Easy to apply, it allows you to shape the hair easily, ensuring a light and long-lasting hold. Perfect for all hair types, Ocean Mist emphasizes its shine and softness, giving a healthy and dynamic look. An essential ally for those looking for a touch of daily freshness and versatile styling, with a natural and sophisticated effect.
in stock
£19.00
Shipping: £5.00
Qathu
Noir stockholm Texture Spray N°104 - 300ml shopify_IT_14985862152516_54376834695492
Say goodbye una frizzy hair once and for all. Volumizing spray REF Texture Spray N104 will add volume to even the finest hair, lifting it from the roots and making it look instantly airy and fuller. At the same time, it does not weigh hair down and does not leave una A greasy feel. It will help you create a beautifully full and airy hairstyle, just the way you dreamed. From now on, everyone will admire it.
£56.00
Shipping: Free
OneBioShop
Full Dry Volume & Texture Spray - Weightless Boost for Fine Hair, 238ml
Full Dry Volume & Texture Spray - Weightless Boost for Fine Hair, 238ml, Health & Beauty > Hair Care & Styling > Styling Products
£36.99
Shipping: Free
eBay - platinum.marketplace
Builder'S Dust, 6 Pack - Instant Texture Spray, Refreshes Hair, Adds Volume & Li
Builder'S Dust, 6 Pack - Instant Texture Spray, Refreshes Hair, Adds Volume & Li, Health & Beauty > Hair Care & Styling > Styling Products
£46.94
Shipping: Free
eBay - ashaz-110
R+Co BLEU Ultra Dry Texture Spray OPC-PHXQ8WG-NEW
Optimal grip meets sultry texture. Build the perfect amount of control for full-on texture shine and volume that remains touchable no matter how...
£71.87
Shipping: Free
OnBuy
Goldwell Stylesign Heat Styling Blowout Texture Spray 200 ml shopify_IT_9807635022104_50427903410456
Stylesign Heat Styling Blowout & Texture Spray by Goldwell | Drying texturizing spray | 2 in 1 spray. On wet hair: ideal for drying, providing up to 100% more volume On dry hair: provides buildable hold and texture | Instant Revival Technology: Simply press the hair to refresh the volume and texture
in stock
£20.00
Shipping: £5.00
Qathu
Rust-Oleum Textured Spray Paint - Aged Iron 400ml AE0080003E8
Give your home or garden projects a fresh edge with Rust-Oleum Textured Spray Paint. Whether you want to transform dated furniture or breathe new life into tired metalwork, this spray paint delivers an instant upgrade with its unique multi-colour, tactile finish. Say goodbye to flat, boring surfaces and enjoy the convenience of a quick-drying formula that adheres beautifully and covers fast, indoors or out. Achieves a decorative, multi-coloured textured effect for an authentic look. Formulated for excellent coverage, so you can complete projects quickly and efficiently Suitable for use on wood and metal, can be used on other surfaces when paired with a Rust-Oleum primer Durable enough for both interior and exterior use, ensuring your results stand up to daily life and changing weather Available in four stylish finishes and a handy 400ml aerosol can, perfect for a wide range of upcycling and décor ideas
£14.00
Shipping: Free
Rust-Oleum
Rust-Oleum Textured Spray Paint - Deep Forest 400ml AE0080004E8
Give your home or garden projects a fresh edge with Rust-Oleum Textured Spray Paint. Whether you want to transform dated furniture or breathe new life into tired metalwork, this spray paint delivers an instant upgrade with its unique multi-colour, tactile finish. Say goodbye to flat, boring surfaces and enjoy the convenience of a quick-drying formula that adheres beautifully and covers fast, indoors or out. Achieves a decorative, multi-coloured textured effect for an authentic look. Formulated for excellent coverage, so you can complete projects quickly and efficiently Suitable for use on wood and metal, can be used on other surfaces when paired with a Rust-Oleum primer Durable enough for both interior and exterior use, ensuring your results stand up to daily life and changing weather Available in four stylish finishes and a handy 400ml aerosol can, perfect for a wide range of upcycling and décor ideas
£14.00
Shipping: Free
Rust-Oleum
Angry Beards Salty Sailor salt texture spray for men 100 ml shopify_IT_14860812845380_53872043327812
Do you want to add? una Want to give your hairstyle a new dimension by shaping it the way you want? Get help from a styling product. Angry Beards Salty Sailor . Allows you to highlight the struttura naturale Give your hair the definition and shape you desire, creating a perfect style in the comfort of your own home that will look like it just came from a professional. Try this styling product and let it enhance your hairstyle while keeping it in place for a long time.
£21.00
Shipping: Free
OneBioShop
Bumble and bumble. Thickening Dryspun Texture Spray | Volumizing + Adds Texture | Straight to Wavy 8.2 Ounce OPC-PFY8RX7-NEW
Bumble and bumble. Thickening Dryspun Texture Spray | Volumizing + Adds Texture | Straight to Wavy 8.2 Ounce. Bumble and bumble Thickening Dryspun...
£76.86
Shipping: Free
OnBuy
R+Co Trophy Shine + Texture Spray 198 ml / 6 oz OPC-PH8KQ7H-NEW
Product DescriptionWin big with TROPHY a styling spray that adds the right amount of texture volume and shine to any hair type. Hair looks naturally...
£54.38
Shipping: Free
OnBuy
SLG Brands Johnny'S Chop Shop Builder'S Dust, 6 Pack - Instant Texture Spray, Refreshes Hai
Johnny'S Chop Shop Builder'S Dust, 6 Pack - Instant Texture Spray, Refreshes Hai, Health & Beauty > Hair Care & Styling > Styling Products
£48.66
Shipping: Free
eBay - arks4u
Hoegoa Hair Texturizing Spray Long Lasting Hold Volumizing Soften Hair Smoothing Deep Hydrating Lightweight Sea Salt Spray 100ml 1005011782832229
Hoegoa Hair Texturizing Spray Long Lasting Hold Volumizing Soften Hair Smoothing Deep Hydrating Lightweight Sea Salt Spray 100ml
£3.69
Shipping: £1.99
AliExpress UK
Instant Volume & Texture Hair Spray - Heat Protection & Paraben-Free, 92g
Instant Volume & Texture Hair Spray - Heat Protection & Paraben-Free, 92g, Health & Beauty > Hair Care & Styling > Styling Products
£26.50
Shipping: Free
eBay - click4deliver
Living Proof Full Dry Volume & Texture Spray 7.5 Oz (Pack of 3) OPC-PFF5PB9-NEW
Living Proof Full Dry Volume & Texture Spray is a lightweight texturizing spray that creates instant volume and body without weighing hair down.
£92.33
Shipping: Free
OnBuy
Living Proof Full Dry Volume & Texture Spray 7.5 fl oz 2-Pack OPC-PFY8XNX-NEW
Aversatiletexturizingspraythatturnsupthevolumeondifferentstylesforanimperfectlyperfectlived-inlookandfeel.
£98.93
Shipping: Free
OnBuy
POVRCH SURFACE Hair Awaken Texture Spray For Volumizing and Lifting Fine Hair 4 fl. Oz. OPC-PGTG9YV-NEW
...
£53.11
Shipping: Free
OnBuy
OUAI Wave Spray - Hair Texture Spray for Perfect, Effortless Beachy Waves - Curl Enhancing Spray Adds Texture, Body & Shine - Safe for Color Treated OPC-PMXVGNQ-NEW
Features The Ultimate Beach Hair Is This OUAI - Get beach waves without stepping foot in the ocean. Our Wave Spray gives you the perfect amount of...
£800.00
Shipping: Free
OnBuy
Salty Dog Salt Spray - Hair Texture & Volume Spray - Beach Textured Hair, Natura
Salty Dog Salt Spray - Hair Texture & Volume Spray - Beach Textured Hair, Natura, Health & Beauty > Hair Care & Styling > Styling Products
£35.86
Shipping: Free
eBay - arks4u
Alterna Sea Salt Spray Texture and Waves 147ml
Alterna Sea Salt Spray Texture and Waves 147ml, Health & Beauty > Hair Care & Styling > Styling Products
£10.88
Shipping: Free
eBay - londonsalon
Kenra Professional Kenra Platinum Dry Texture Spray 6 | Texture Defining Styler | Increases Texture & Fullness | Absorbs Oils & Impurities | Ultra-Lightweight Non-Dryin OPC-PFRJWMQ-NEW
Kenra Platinum Dry Texture Spray increases texture and fullness. Ultra-lightweight non-drying formulation leaves the hair with a matte finish while...
£67.49
Shipping: Free
OnBuy
Living Proof Full Dry Volume & Texture Spray 7.5 Oz (Pack of 2) OPC-PFF5PBB-NEW
Living Proof Full Dry Volume & Texture Spray is a lightweight texturizing spray that adds instant volume and texture to hair without weighing it...
£74.41
Shipping: Free
OnBuy
R+Co Zig Zag Root Teasing + Texture Spray 177 ml / 5 oz OPC-PGG9BHC-NEW
...
£54.38
Shipping: Free
OnBuy
OUAI Wave Spray Travel Size - Texture Spray for Hair with Coconut Oil and Rice Protein - Adds Texture, Volume & Shine for Beach Waves - Paraben Free, OPC-PMXVHZ9-NEW
Features The Ultimate Beach Hair Is This OUAI - Get beach waves without stepping foot in the ocean. Our Wave Spray gives you the perfect amount of...
£800.00
Shipping: Free
OnBuy
Keranique Hair Thickening Spray - Lift & Repair Volumizing Spray for Instant Volume Texture - Styling Texturizing Spray For Fine Hair - Heat Damage Pr OPC-PFY5X7C-NEW
...
£50.00
Shipping: Free
OnBuy
Refine Search
Filters
Clear All
Category
✓Price
✓Brand
0Seller
0