Sorry, nothing was found. Please change your selection and try again.
Volumizing Spray
(241 - 280 of 810 results)
Filters
Best Match
Best Match
Price: Low to high
Price: High to low
Victoria's secret Midnight Bloom - body spray - Volume: 250 ml shopify_IT_15141247516996_54975712461124
Discover the magic of Victoria''s Secret Midnight Bloom, a 250 ml body spray that envelops the skin in a sophisticated and seductive una fragranza. This light and velvety lotion is quickly absorbed, offering an immediate sensation of freshness and deep hydration, leaving the skin soft and silky. The exclusive fragrance combines enveloping floral notes with sensual hints, ideal for chi who wants to express elegance and charm at any time of the day. Perfect for daily use, Midnight Bloom enhances femininity with delicacy, transforming your beauty routine into a unique sensory experience. An essential product for chi seeking refinement and well-being in a single gesture.
£27.00
Shipping: Free
OneBioShop
Str8 Wild Beat - Deodorant Spray - Volume: 150 ml shopify_IT_10074131169560_51649224048920
Wild Beat by Str8 is a 150 ml spray deodorant that guarantees una long-lasting protection against sweat and unpleasant odors, keeping una a feeling of freshness throughout the day. Its lightweight formula dries quickly without leaving stains, ideal for those seeking practicality and reliability. With an energetic and dynamic fragrance, Wild Beat stands out for its ability to enhance the masculine personality, offering una the perfect combination of effectiveness and style.
in stock
£9.00
Shipping: £5.00
Qathu
Diego dalla palma Ultra Bombato Spray Volume 150 Ml shopify_IT_15210029580612_55346734235972
Description | Instant-effect spray, creates volume without weighing it down. Enriched with VOLU-UP COMPLEX, it shapes hair, for una fold naturale with a volume-enhancing effect. | | Ingredients | | Directions for use | | Results | | Benefits | | Manufacturer | | Immediate-effect spray, creates volume without weighing it down. Enriched with VOLU-UP COMPLEX, it shapes the hair, for una fold naturale with volume effect.
£31.00
Shipping: Free
OneBioShop
Humidifier for Bedroom 3L Dual Nozzle Household Mute Bedroom Usb Air Humidifier Office Desktop Worker Hydration Fog Volume Spray Machine(White) EQAEQQBCJ-WHITE
3L large capacity, double spout design, double humidification experience, quickly say goodbye to dryness. Adopt type-c charging use, Changan on/off key 1.5 seconds to turn on the night light. Running noise is equal to 32dB, humidification does not disturb sleep, night can also be used. Adopt silver ion material, long-lasting filtration, take care of your and your family's health. Continuous spray timer 10 hours, intermittent spray timer 20 hours. It can create a quieter sleeping environment. Humidifiers can humidify your living space to prevent dry and stuffy air., Manufacturer: Hhmmei2024-23
£50.02
Shipping: Free
Amazon Marketplace - minghuaouzhou
Humidifier for Bedroom 3L Dual Nozzle Household Mute Bedroom Usb Air Humidifier Office Desktop Worker Hydration Fog Volume Spray Machine(Green) EQAEQQBCJ-GREEN
3L large capacity, double spout design, double humidification experience, quickly say goodbye to dryness. Adopt type-c charging use, Changan on/off key 1.5 seconds to turn on the night light. Running noise is equal to 32dB, humidification does not disturb sleep, night can also be used. Adopt silver ion material, long-lasting filtration, take care of your and your family's health. Continuous spray timer 10 hours, intermittent spray timer 20 hours. It can create a quieter sleeping environment. Humidifiers can humidify your living space to prevent dry and stuffy air., Manufacturer: Hhmmei2024-23
£50.02
Shipping: Free
Amazon Marketplace - minghuaouzhou
IGK No Limit Dry Volume And Thickening Spray 177 ml / 5.4 oz OPC-PFY7D89-NEW
IGK No Limit Dry Volume And Thickening Spray 177 ml / 5.4 oz. Product Description""""This featherlight volumizing and thickening...
£51.86
Shipping: Free
OnBuy
Beauty by Earth Sea Salt Spray for Hair Men & Women - Beach Waves Texturizer Fine Texturizing Texture Volumizing Spray Women Clear 6 Fl Oz (Pack o OPC-PNSJZV9-NEW
Its PERFECT FOR ALL HAIR types. Whether you have thick wavy hair or super fine hair this salt water spray will work with your individual hair type.
£55.66
Shipping: Free
OnBuy
K18 Womens Biomimetic Hairscience AstroLift Volume Spray - 118ml - One Size 0198654e-eb79-75ee-8543-2bac1a22da46
Discover the K18 Biomimetic Hairscience AstroLift Reparative Volume Spray, a revolutionary lightweight mist designed to elevate your hair care routine. This 118ml volume spray lifts roots and thickens strands, all while repairing damage over time with the power of K18PEPTIDE. Enjoy fuller, softer, and more resilient hair without the stiffness. Perfect for fine or fragile hair, it delivers long-lasting, natural-looking volume. Plus, it's cruelty-free and vegan-friendly, making it an ethical choice for your beauty regimen.
Standard Delivery
£38.87
Shipping: £2.99
Secret Sales
Schwarzkopf professional Freeze Pump - Super strong volume hair spray bottle 200 ml shopify_IT_10041796821272_51576716656920
Freeze Pump by Schwarzkopf Professional is a una super strong hairspray of 200 ml, ideal for securing any hairstyle with extreme hold. Thanks to its innovative formula, it ensures long-lasting hold without weighing down the hair or leaving residues. Perfect for creating defined and secure looks, it keeps the style impeccable even in humid conditions. The convenient pump dispenser ensures precise and even application, making Freeze Pump the professional choice for controlled and long-lasting styling.
in stock
£13.00
Shipping: £5.00
Qathu
Syoss Keratin Volume heat protection spray for hair to increase volume 200 ml shopify_IT_15096432132420_54782575706436
Now you can finally have healthy, voluminous hair. The secret is Syoss Keratin, a volumizing and heat-protecting spray. Each spray of this lightweight spray not only protects hair from high heat, but also adds up to double the volume.
£11.00
Shipping: Free
OneBioShop
Luxurious Lightweight Mist for Instant Root Lift & Lasting Volume - 200ml Spray
Luxurious Lightweight Mist for Instant Root Lift & Lasting Volume - 200ml Spray, Health & Beauty > Hair Care & Styling > Styling Products
£43.99
Shipping: Free
eBay - diamond-marketplace
Thierry Mugler Alien - Deodorant Spray - Volume: 100 ml shopify_IT_10074143752472_51649236631832
Indulge in Alien with the Spray Deodorant. A body ritual with refreshing and fragrant virtues
in stock
£62.00
Shipping: £5.00
Qathu
Clarins Eau Dynamisante body spray - Volume: 100 ml shopify_IT_8787986514244_47645872783684
Eau Dynamisante Treatment Water by Clarins | The iconic first treatment Clarins Water! | | Benefits: | Made with 95% natural ingredients, it revitalizes and tones the body and mind. It's perfect for starting the day off right or combating temporary fatigue. Skin regains all its energy and firmness thanks to the stimulating action of organic red ginseng extract combined with the invigorating power of organic lemon thyme extract. Its iconic red bottle is refillable. | The richness of this treatment Clarins Water comes from the quintessenza from plants: essential oils. These are nature's authentic concentrates, secreted in small quantities by aromatic plants and subsequently extracted. They deliver all their benefits to the skin and spirit. *The 200 ml size does not include a spray bottle.
£61.00
Shipping: Free
OneBioShop
Afnan Palace Of Dreams - home spray - Volume: 300 ml shopify_IT_8617681420612_46974744232260
The room fragrance Afnan Heritage Collection Blooming Love perfumes your home beautifully with just a touch. Thanks to its immediate effect, you can enjoy its pleasant scent just when you need it.
£17.00
Shipping: Free
OneBioShop
Goldwell Stylesign Volume Root Boost Spray 200 ml shopify_IT_9522192023876_49112469373252
Give your hair instant and long-lasting volume. The spray Goldwell StyleSign Root Boost Spray instantly lifts fine, weakened roots for up to 48 hours of volume. mirato. It will finally give you the hairstyle you never dreamed of. Fine, normal hair will literally come back to life and will never be lazy or limp again.
£20.00
Shipping: Free
OneBioShop
Alfaparf Sdl Sublime Cristalli Spray - Volume: 125 ml shopify_IT_8785634001220_47633974657348
Enjoy a moment of glory like una Milan fashion show. Hair spray Alfaparf Milano Semi di Lino Sublime Cristall will illuminate your hair as if it were under the spotlight. At the same time tempo, It leaves them soft and velvety and prevents frizz.
£32.00
Shipping: Free
OneBioShop
Eucerin Aquaphor (Body Ointment Spray) - Volume: 250 ml shopify_IT_8849075700036_47883383603524
Reviews | Aquaphor Repair Treatment Eucerin - For Dry and Damaged Skin | Innovative anhydrous spray that instantly soothes, providing relief from dry and very dry, irritated, and damaged skin on any part of the body. This innovative Spray Treatment is ideal for arms, legs, and other large or hard-to-reach areas. It keeps skin hydrated and accelerates the skin's regeneration process. Do not use on the face. | Eucerin Aquaphor Repair Treatment Spray for dry and damaged skin. When the barrier function is damaged, the skin becomes more sensitive to external irritants. Irritated skin may require more than una simple cream for essere really soothed. Una cream can essere useful for repairing dry or irritated skin, but can essere difficult and demanding tempo apply una cream on large areas of the body such as the arms, legs and torso. For an easy and immediate refreshing effect on the larger parts of the body, we have created Eucerin Aquaphor Repair Treatment Spray. The innovative spray that allows you to reach any part of the body. The dispenser allows for continuous and uniform application of the treatment and can essere It can also be used upside down – thus reaching 360° dry skin on any part of the body. Aquaphor Repair Treatment Spray has been clinically proven to repair dry and damaged skin, creating una Ideal protective barrier for skin regeneration and an immediate sensation of refreshment and relief. The formula is enriched with Glycerin and Panthenol to help maintain skin hydration levels and promote the regeneration and repair process. Free from preservatives and fragrance, this SOS spray treatment has been clinically proven to be a highly hydrating product that provides relief from very dry skin. Skin is visibly regenerated, protected, and repaired. | | Ingredients: Butane, Paraffinum Liquidum, Microcrystalline Wax, Paraffin, Lanolin-alcohol, Panthenol, Glycerin, Bisabolol. | | Format: 250ml spray bottle.
£33.00
Shipping: Free
OneBioShop
Kemon Actyva Volume E Corposita Spray 125 ml shopify_IT_9979899707672_51270890914072
Kemon Actyva Volume and Body Spray 125 ml is a professional treatment ideal for those who wish to give body and support to fine and voluminous hair. Its lightweight and non-weighty formula acts directly on the hair fiber, offering una soft and natural texture, without residues. Thanks to its volumizing and strengthening action, the product helps maintain healthy hair growth, facilitating styling and improving hold. Perfect for a fresh and dynamic look, this spray has been developed with quality ingredients to ensure long-lasting results and a fuller, more vibrant appearance. Kemon Actyva is the ideal choice for those seeking effectiveness and professional care in one product.
in stock
£12.00
Shipping: £5.00
Qathu
Str8 Game - Deodorant With Spray - Volume: 85 Ml shopify_IT_10074131300632_51649224179992
The Game Spray Deodorant by STR8 highlights the hidden passion deep within a man's character. Embrace the challenge brought by this fragrance and show what truly gives meaning to your life. Live fully, be bold, and do what makes you truly happy. This product helps you stay fresh and confident in any situation.| Features of the STR8 Game Spray Deodorant: | - Leaves a pleasant trail with woody and relaxing notes; - Opens with hints of pineapple, coriander, and apple; - Continues with hints of orange blossom, tonka bean, and lavender; - Concludes with accords of amber wood, vanilla, and praline; - Provides a feeling of freshness for up to 48 hours; - Exhibits moisturizing properties; - Softens the skin; - Offers antimicrobial action against gram-positive bacteria; - Contains a physiological antioxidant necessary to maintain the stability of cell membranes. || Shake well and spray the deodorant on the body for a una immediate feeling of freshness.|| Alcohol Denat., Aqua, Parfum, PPG-20 Methyl Glucose Ether, BHT, Alpha-Isomethyl Ionone, Citral, Citronellol, Coumarin, Eugenol, Limonene, Linalool.
in stock
£10.00
Shipping: £5.00
Qathu
Str8 Rise - Deodorant Spray - Volume: 150 Ml shopify_IT_10074131431704_51649224311064
Rise by Str8 is a 150 ml spray deodorant designed to provide una effective and long-lasting protection against sweat and unpleasant odors. Its fresh and gentle formula ensures an una immediate feeling of cleanliness, keeping a una pleasant fragrance throughout the day. Ideal for those seeking comfort and security during the most intense days, Rise ensures a quick and even application, without sticky residues. Perfect for those who love a dynamic and polished style at all times.
in stock
£7.00
Shipping: £5.00
Qathu
Living Proof Full Dry Volume & Texture Spray 7.5 Oz (Pack of 3) OPC-PFF5PB9-NEW
Living Proof Full Dry Volume & Texture Spray is a lightweight texturizing spray that creates instant volume and body without weighing hair down.
£92.33
Shipping: Free
OnBuy
Living Proof Full Dry Volume & Texture Spray 7.5 fl oz 2-Pack OPC-PFY8XNX-NEW
Aversatiletexturizingspraythatturnsupthevolumeondifferentstylesforanimperfectlyperfectlived-inlookandfeel.
£98.93
Shipping: Free
OnBuy
Pettenon Rr Line Styling Pro Spray Volume Roots 250 ml shopify_IT_9979303100696_51249324523800
The RR Line Styling Pro Volume Creator Volumising Spray of 250ml is the ideal secret for those who desire a una fuller and more voluminous mane. This professional spray, formulated with high-quality ingredients, provides struttura and body to the hair without weighing it down, facilitating styling and ensuring una long-lasting hold. Perfect for all hair types, it enhances styling control and gives a natural and lightweight effect. Its spray texture allows for an even application, amplifying volume from roots to tips. Thanks to the combination of effectiveness and practicality, the RR Line Styling Pro Volume Creator is the perfect companion for anyone looking for a fresh, dynamic, and well-groomed look on any occasion.
in stock
£11.00
Shipping: £5.00
Qathu
Rituals The Ritual Of Karma Body and Hair Spray volume bottle 50 ml shopify_IT_10041796100376_51576715903256
The Ritual Of Karma Hair & Body Mist by Rituals is a delicate spray of 50 ml, ideal for body and hair. Its formula envelops the skin and hair in a una fresh and enveloping fragrance, enriched with essences of patchouli and sweet orange. It instantly refreshes, providing a una feeling of lightness and well-being both during the day and after a shower. Perfect for those who desire a touch of natural freshness and a lasting scent at any moment.
in stock
£33.00
Shipping: £5.00
Qathu
Ted lapidus Rumba - eau de toilette spray - Volume: 100 ml shopify_IT_8852601766212_47894091333956
Don't hide the passionate side of your personality. Eau de toilette Ted Lapidus Rumba is full of excitement, desire, and provocation, and will tune you and everyone around you into sensual vibes.
£27.00
Shipping: Free
OneBioShop
Women'Secret So Captivating - Sparkling Fragrance Spray - Volume: 250 Ml shopify_IT_10074278265112_51649376059672
A romantic date, una special dinner, or una evening with friends? The Women Secret So Captivating body spray is the right choice for any occasion. Discover this fragrance that will wonderfully complement your unique charisma.
in stock
£13.00
Shipping: £5.00
Qathu
Iconique Professional Hot Like You Heat Protection Spray - Volume: 70 Ml shopify_IT_10073762824472_51648827326744
Hot Like You Heat-Protection Spray by Iconique Professional, 70 ml, effectively protects hair from the heat of hair dryers, straighteners, and curling irons. Its lightweight formula creates a una barrier that prevents thermal damage, keeping the hair fiber healthy and shiny. It makes styling easier, ensuring una long-lasting hold without weighing hair down. Ideal for all hair types, it helps preserve softness and natural volume, providing a luminous and professional finish for any occasion.
in stock
£16.00
Shipping: £5.00
Qathu
Unbranded (As show, One size) Paint Sprayer Spray Volume Control Electric Spray Paint Gun 1200ML 650W With LED Light 3 Replaceable
Feature: 1. High Power Output for Rapid Coverage: Powered by a robust 650W motor, this electric paint sprayer delivers high output air and paint flow,
£97.58
Shipping: £3.50
OnBuy
milk_shake Milk Shake Lifestyling Powder Pop Hair Volume Powder Spray 5g shopify_IT_15147325456708_55004907077956
Does your hair seem lacking in volume and shape? Milk_shake Lifestyling Powder Pop will give it both back. It lifts hair from the roots, making it look instantly airy and full. Plus, you can quickly and easily achieve a voluminous hairstyle like a professional. It gives your hair a lively, casual, and structured look, even without complicated washing and styling.
£25.00
Shipping: Free
OneBioShop
Bruno banani Pure Woman - deodorant with spray - Volume: 75 ml shopify_IT_9746446778648_50068772127000
The Pure Woman spray deodorant by Bruno Banani, with a practical 75 ml format, it offers effective and long-lasting protection against bad odors, ensuring freshness all day long. Its light formula absorbs quickly without leaving sticky residue on the skin, respecting its natural balance. Ideal for dynamic women who want a reliable and refined product, Pure Woman combines performance and a delicate and sensual fragrance, capable of enhancing femininity on every occasion. Easy to carry, it adapts perfectly to an active lifestyle, ensuring comfort and safety at all times. A true beauty ally, which combines effectiveness and a touch of unique charm.
in stock
£9.00
Shipping: £5.00
Qathu
Nivea Diamond Volume Care styling spray 150 ml size shopify_IT_15350212362564_55862416867652
Discover Diamond Volume Care Styling Spray by Nivea, the innovative 150 ml treatment designed for those who want intense volume without sacrificing lightness and shine. Its advanced formula combines diamond micro-pearls, for a sophisticated luminosity, with flexible polymers that shape and support the hair from roots to ends. Enriched with plant-based keratin, this spray nourishes the hair fiber, reduces frizz, and protects from the heat of blow dryers and straighteners. The lightweight texture does not weigh hair down and distributes in a modo even mist, ensuring adjustable hold for up to 24 hours and una anti-humidity hold: your look remains perfect and dynamic, even on the busiest days. Thanks to the fine mist spray brush, application is practical and targeted, ideal for creating defined strands or an everyday naturale effect. Diamond Volume Care Styling Spray is suitable for all hair types and washes out easily with shampoo. It gives body, strength, and extraordinary light reflections, transforming every hairstyle into a daily luxury experience.
£12.00
Shipping: Free
OneBioShop
Tesori d'oriente Hammam - deodorant spray - Volume: 150 ml shopify_IT_9964933021976_51024663314712
Hammam - deodorant spray - Volume: 150 ml
in stock
£6.00
Shipping: £5.00
Qathu
Bruno banani Magic Woman - deodorant with spray - Volume: 75 ml shopify_IT_8786862670148_47640980980036
Transform your perfumes into a harmonious ensemble. The deodorant Bruno Banani Magic Woman releases the same aroma of your perfume in the bottle, together they form una perfect couple.
£15.00
Shipping: Free
OneBioShop
Clarins Eau Des Jardins Body Spray - Volume: 100 ml shopify_IT_9720012275992_49990918340888
Eau des Jardins Treatment Water from Clarins. | It is a treatment water that is used to refresh and beautify the skin. It is a popular product in the field of beauty and personal care due to its delicate fragrance and skin-beneficial properties. Advantages: | The product comes in the form of a light, refreshing spray that is applied directly to the skin. It can be used at any time of the day to provide an instant new sensation and to revitalize tired skin Eau Des Jardins offers a unique sensory experience. Its fragrance combines fresh, citrus notes with herbal and floral touches, creating a refreshing and revitalizing atmosphere. This delicate and natural fragrance remains on the skin for long diverse hours, leaving a pleasant and lasting sensation. | In addition to its fragrance, Eau des Jardins treatment water also offers benefits for the skin. The botanical ingredients and essential oils present in the formula help hydrate, smooth and tone the skin. They can also help balance excess oil, soothe irritation, and improve the overall appearance of the skin.
in stock
£64.00
Shipping: £5.00
Qathu
La Rive Elegant Woman - Deodorant Spray - Volume: 150 ml shopify_IT_10073826394392_51648901611800
The Fragrant Deodorant La Rive Elegant Woman is designed for women who appreciate the balance between comfort and sophisticated fragrance in their daily lives. It not only refreshes but also instills confidence throughout the day, enhancing individuality and femininity. Its lightweight formula is suitable for daily use, ensuring a una feeling of cleanliness in any situation—whether at work, during a una walk, or on a una night out. The compact format is convenient to carry, and the elegante packaging design highlights the style and taste of its owner. This deodorant becomes more than just a hygiene product; it is an integral part of the refined image of the modern woman.| Features of the Fragrant Deodorant La Rive: | - Combines care and fragrance functions; - Long-lasting scent that enhances femininity; - Formula that ensures prolonged freshness; - Does not leave marks on clothes; - Suitable for daily use; - Convenient aerosol format for even application; - Bottle design elegante in una palette refined; - Harmoniously complements the fragrance of this line. || Shake the bottle well before use. Spray the product on the underarms from a distance of 15 cm. Allow the deodorant to dry completely.
in stock
£7.00
Shipping: £5.00
Qathu
Bruno banani Pure Woman - deodorant with spray - Volume: 75 ml shopify_IT_8786862342468_47640980455748
The Pure Woman spray deodorant by Bruno Banani, with a practical 75 ml size, combines elegance and effectiveness for una long-lasting protection. Its fresh and light formula ensures una feeling of cleanliness and comfort all day long, keeping the skin dry and scented. Ideal for dynamic women, this deodorant stands out for its refined and sensual fragrance, able to enhance the personality with una delicate yet persistent scent. Thanks to the spray dispenser, application is quick and even, ensuring practicality even on the busiest days. Pure Woman is the perfect solution for chi who wants to feel confident and pleasant on every occasion, combining protection and style in a single product.
£9.00
Shipping: Free
OneBioShop
Xerjoff Alexandria Ii - Hair Spray - Volume: 30 Ml shopify_IT_10074278494488_51649376289048
Xerjoff Alexandria II Hair Mist is a una unisex woody hair fragrance. Enriched with high-quality natural ingredients, Alexandria II Hair Mist 30 ml stands out for its ability to nourish and care for hair comprehensively. This exclusive formula not only hydrates and protects hair but also gives it a luxurious body and una radiant shine. Thanks to its conditioning properties, the hair's keratin is reinforced, ensuring a una soft, light, and vibrant mane. As the mist gently settles on the hair, it releases the opulent notes of the precious Alexandria II fragrance, enveloping the senses in a whirl of luxurious scent. This hair mist not only provides a una feeling of freshness and vitality but also transforms every day into a sensory luxury experience.
in stock
£259.00
Shipping: Free
Qathu
Schwarzkopf professional Silhouette Flexible Hold - Hair Spray volume bottle 750 ml shopify_IT_10041796624664_51576716460312
Silhouette Flexible Hold by Schwarzkopf Professional is una hair spray in 750 ml that guarantees una flexible and long-lasting hold, ideal for a natural style without stiffness. Its advanced formula sets the hairstyle, protects against humidity, and adds shine while maintaining hair movement throughout the day. Perfect for all hair types, it ensures control and definition without weighing down, making every hairstyle flawless and resistant to external stresses. A professional product designed for refined and lasting results.
in stock
£23.00
Shipping: £5.00
Qathu
Milk shake In Good Hands Cosmetic Hand Cleansing Spray - Volume: 500 ml shopify_IT_15141237915972_54975700566340
The Milk Shake In Good Hands Cosmetic Hand Cleansing Spray, with a practical 500 ml format, combines effectiveness and gentleness for an impeccable daily una cleansing. Thanks to its innovative formula, it removes impurities and bacteria without drying out the skin, keeping hands soft and hydrated. Perfect for chi who want a quick and versatile product, the spray guarantees una a long-lasting feeling of freshness and an enveloping fragrance typical of the Milk Shake line. Ideal for frequent use, it protects and strengthens the skin barrier, offering a complete cosmetic treatment. The convenient spray dispenser makes application simple and hygienic, turning your cleaning routine into a moment of well-being and personal care.
£14.00
Shipping: Free
OneBioShop
Ahmed al maghribi Al Shaikha Hind - hair spray - Volume: 50 ml shopify_IT_15350956949828_55865870025028
Al Shaikha Hind by Ahmed al Maghribi is an innovative hair spray with a volume of 50 ml, designed to give thickness and vitality to the hair. Its lightweight formula ensures una hold naturale without weighing it down, ideal for chi who want a defined yet soft-to-the-touch look. This product nourishes the hair, improving its texture and making daily styling easier. Perfect for all hair types, Al Shaikha Hind protects against external aggressions while preserving the shine naturale. Thanks to its practical compact format, it is convenient to always carry with you, allowing you to refresh and style your hair at any time of the day. A must-have for chi who seek quality and performance in a professional product.
£17.00
Shipping: Free
OneBioShop
Refine Search
Filters
Clear All
Category
✓Price
✓Brand
0Seller
0