Sorry, nothing was found. Please change your selection and try again.
Electric Ovens
(841 - 880 of 4,855 results)
Filters
Best Match
Best Match
Price: Low to high
Price: High to low
Bosch Series 4 HQA574BB3B Built In Electric Oven,
This Bosch Series 4 HQA574BB3B Built In Electric Oven, Black is designed to provide reliable performance and practical everyday use. Built with...
£998.41
Shipping: Free
OnBuy
Montpellier MCERPACK Integrated Single Electric Oven Ceramic Hob Pack â Bu
Montpellier MCERPACK Integrated Single Electric Oven Ceramic Hob Pack - Bu is a premium-quality product designed for reliable everyday performance.
£469.12
Shipping: £3.95
OnBuy
Montpellier 500mm Single Electric Oven and Grill White CSE46W
Montpellier 500mm Single Electric Oven and Grill White CSE46W, Home, Furniture & DIY > Appliances > Cookers, Ovens & Hobs > Cookers
£279.00
Shipping: Free
eBay - electricaldiscountuk
Zanussi ZOB35471WK Multifunction Built-In Electric Oven - White Steel NEW
Zanussi ZOB35471WK Multifunction Built-In Electric Oven - White Steel NEW, Home, Furniture & DIY > Appliances > Cookers, Ovens & Hobs > Ovens
£279.99
Shipping: £60.00
eBay - lottsforyoulimited
SMEG SF6200TSI Musa Electric Oven - Silver, Silver/Grey 10299587
Enjoy perfectly cooked meals every time with this Smeg electric oven. Its Circulaire function keeps the air clean as you're cooking to stop flavours and odours from mixing. That means you won't have to worry about your roast tasting like a grilled fish. Plus, it's a multifunction oven, which means it's got loads of cooking programs to choose from. And the Vapor Clean function uses steam to soften and lift dirt and grease. All that's left to do is give it a quick wipe and you're done.Good to know- The fan blows hot air around the whole oven for fast, even cooking- Its 70-litre capacity is big enough for family dinners or get-togethers- The enamel coating on the inside can easily be wiped off using a damp cloth- Its removable glass door makes it easy to give it a deep clean- The DigiScreen LED display is easy to see, even from the other side of the kitchen_________________________________________PLEASE NOTE:ELECTRICAL INSTALLATION: This product requires professional installation to a 13 Amp fused spur by a qualified installer, such as one of our Tech Experts.
"1 to 3 days"
£399.00
Shipping: £45.00
Currys
Hotpoint DUH10DIX Built In Double Electric Oven - S/Steel 7722202
This Hotpoint Built Under Double Oven offers flexibility for everyday cooking, with a 48l main oven and 38l top oven for quick meals or family roasts. The main cavity uses fan-assisted heat for even cooking, while the top oven serves as a multifunction space and grill, with full-width or half-power grill options. Both cavities have easy-clean enamel liners, and the Diamond Clean function uses steam to simplify wiping down. The LED display and programmable timer let you set it and forget it, alerting you when dinner's ready without hovering in the kitchen. With double-glazed doors, interior lights in both ovens, and dial controls, it's straightforward to use and fits neatly under your worktop in a standard 60cm aperture. You get 2 shelves in each cavity, plus slow cook and defrost functions for when you need them. It needs hardwiring into a cooker point, and both cavities carry an A energy rating with 0.72kWh for the main oven and 0.68kWh for the top. Finished in stainless steel, it comes with a 10-year parts and 1-year labour guarantee from the manufacturer. Enamel Liners in Both Cavities - Hotpoint has your oven cleaning covered with easy to wipe clean enamel liners, so you spend less time cleaning the oven. Overview:Digital clock. Programmable digital display timer. LED display. Door window glazing: double glazed. Slow cook function. Defrost function. Dial control. Front mounted controls. Main cavity:Fan oven cavity with 2 shelves. 48 litre capacity. Interior light. Main cavity door hinge position: bottom. Easy-clean enamel. Easy clean interior. Energy efficiency rating A. Energy consumption 0.72kWh. Second cavity:Multifunction oven & grill cavity with 2 shelves. 38 litre capacity. Interior light. Door hinge position: bottom. Easy-clean enamel. Easy clean interior. Energy efficiency rating A. Energy consumption 0.68kWh. Grill:Electric (full width) grill. Combined with top oven. Dimensions:Oven size H71.5, W59.4, D57.5cm. Oven to fit aperture (space required H72, W60, D57cm). Fits under worktop. General information:Oven needs to be hard wired into a cooker point on the wall and on its own circuit. Manufacturer's 10 year parts and 1 year labour guarantee. EAN: 5054645712748.
3 to 5 day
£419.00
Shipping: £9.95
Argos
Hisense BID75211BGUK Built Under Double Electric Oven-Black 4721165
This Hisense Built Under Double Electric Oven handles big family meals and entertaining with a 54l main fan oven and a 38l second cavity that doubles as a multifunction oven and full-width grill. The main cavity circulates heat evenly for crispy edges and juicy centres, while the second oven's grill is perfect for finishing lasagne, melting cheese on toast, or browning shepherd's pie. The LED touch display and dial controls provide easy access to temperatures and timing, and the built-in defrost function adds versatility. Cleaning is hassle-free with grease-proof enamel liners in both cavities. A quick wipe and you're done. Both ovens have interior lights and double-glazed doors to keep heat in and your kitchen cooler, plus 5 shelves in the main cavity and 3 in the second for flexible cooking. Designed to fit under your worktop or at eye level, it requires hardwiring into a cooker point and fits standard apertures at 56cm wide by 55cm deep. With A-rated energy efficiency (0.77kWh main, 0.68kWh second), a programmable timer, and a 2-year guarantee, it's built to handle whatever you're cooking without fuss. Double Oven - Boosting an XL capacity of 54/38L, the main electric fan oven gives you fast and efficient cooking, heating food evenly so that everything you cook is perfectly done – crispy on the outside, juicy on the inside. What's more the second electric oven has a useful grill setting, which gives food a deliciously crispy top. Overview:Digital clock. Programmable digital display timer. LED display. Door window glazing: double glazed. Defrost function. Dial control. Front mounted controls. Main cavity:Fan oven cavity with 5 shelves. 54 litre capacity. Interior light. Main cavity door hinge position: bottom. Easy-clean enamel. Easy clean interior. Energy efficiency rating A. Energy consumption 0.77kWh. Second cavity:Multifunction oven & grill cavity with 3 shelves. 38 litre capacity. Interior light. Door hinge position: bottom. Easy-clean enamel. Easy clean interior. Energy efficiency rating A. Energy consumption 0.68kWh. Grill:Electric (full width) grill. Combined with top oven. Grill tray included (no handle). Dimensions:Oven size H72, W59.4, D56.3cm. Oven to fit aperture (space required H72, W56, D55cm). Fits in eye level worktop. Fits under worktop. General information:Oven needs to be hard wired into a cooker point on the wall and on its own circuit. Manufacturer's 2 year guarantee. EAN: 3838782434549.
3 to 5 day
£359.00
Shipping: £9.95
Argos
AEG DUB535060B Built Under Double Electric Oven - Black 7767157
This AEG Built Under Double Oven offers two ovens to cook different dishes at different temperatures without juggling. The main cavity has 45l with multifunction and grill, the second 42l as a conventional oven, both with catalytic liners that break down grease for less scrubbing. The Hot Air convection system circulates heat evenly in the main oven, cooking up to 20% faster and reducing energy use. The Explore LED display and touch buttons make adjusting times and temperatures easy, and the removable glass door simplifies cleaning. Both ovens have double-glazed doors to keep the heat in, interior lights so you can check on your cooking without opening the door, and easy-clean interiors. It's designed to fit under your worktop and needs hardwiring into a cooker point. With an A energy rating on both cavities - 0.85kWh for the main and 0.78kWh for the second - plus a child lock and 2-year manufacturer's guarantee, it's built to handle everyday family cooking without the fuss. With this oven, using energy efficiently also means cooking efficiently. It has a new convection system called Hot Air, which ensures hot air circulates evenly throughout the oven cavity. The result is that the oven heats up faster and cooking temperatures can be reduced by up to 20%, saving you both time and energy. Overview:Digital clock. Programmable digital display timer. LED display. Door window glazing: double glazed. Defrost function. Front mounted controls. Delayed start. Main cavity:Multifunction oven & grill cavity with 2 shelves. 45 litre capacity. Interior light. Main cavity door hinge position: both sides. Catalytic liners. Easy clean interior. Energy efficiency rating A. Energy consumption 0.85kWh. Second cavity:Conventional oven cavity with 2 shelves. 42 litre capacity. Interior light. Door hinge position: both sides. Catalytic liners. Easy clean interior. Energy efficiency rating A. Energy consumption 0.78kWh. Grill:Electric (full width) grill. Combined with oven. Dimensions:Oven size H71.5, W59.4, D56.8cm. Oven to fit aperture (space required H24.7, W44, D41.6cm). General information:Oven needs to be hard wired into a cooker point on the wall and on its own circuit. Child lock. Manufacturer's 2 year guarantee. EAN: 7333394054759.
3 to 5 day
£599.00
Shipping: £9.95
Argos
26L Electric Oven and Grill，Temperature Control 80℃ Up to 240℃ QCBVDDBVD
[Special Features] Multiple cooking functions and hot air blowers, the mini oven has multiple optional heating functions, which can meet all your cooking needs, such as grilling, grilling and baking. [Simple] Timer and circulating air function, top heating, bottom heating, top and bottom heating, our mini oven has high quality standards. [Customer Service] Always provide our customers with the best products and best service. Contact us at any time if you have any questions, we will solve your doubts. [Easy to use] Compared with the digital touch screen air fryer oven, this oven can achieve multiple functions through the operation of 2 knobs, which is suitable for people of all ages. More importantly, it is more durable and stable. With its versatile design, suitable for roasting, baking, grilling and reheating, this mini oven allows you to enjoy a wide variety of cooking options., Manufacturer: uoXHFdh
£322.65
Shipping: Free
Amazon Marketplace - KYPGS
HOOVER HOC3158IN Electric Oven - Stainless Steel & Black, Stainless Steel 10239666
Good to know- Cleaning your oven is easier with Hydro Easy Clean - the 30 minute cycle softens dirt so you can just wipe it away- The multifunction oven uses 12 combinations of the heating elements to provide great cooking for almost any meal- The pizza setting cooks your pizzas to perfection with a crispy base- An anti-fingerprint stainless steel finish means your oven always looks as good as new_________________________________________PLEASE NOTE: ELECTRICAL INSTALLATION: This product requires professional installation to a 13 Amp fused spur by a qualified installer, such as one of our Tech Experts.
"1 to 3 days"
£229.00
Shipping: £45.00
Currys
BEKO Pro AeroPerfect BBIMA17300BC Electric Oven - Black, Black 10287245
Unlock a whole new level of cooking flexibility with this Beko multi-function oven. Bake flawless cupcakes, serve up a mouth-watering Sunday roast or fire up the grill to crisp up the top of your dishes. And no matter what's on the menu, AeroPerfect technology makes sure everything comes out evenly cooked. It maintains a constant airflow throughout the oven cavity, reducing temperature swings. Your meals will be ready quicker too! And with the special AirFry tray, the oven doubles as an air fryer. Whip up crispy, delicious meals with minimal oil — no need for another appliance cluttering your countertop.Good to know- The catalytic back wall catches grease and grime, making cleaning quicker and less of a chore- Its SimplySteam technology uses steam to loosen stubborn residue, so scrubbing becomes a breeze- A large 72 litre capacity makes this oven perfect for big family feasts or cooking multiple dishes at once- The Deep Black design hides the interior when the oven lights are off, keeping your kitchen looking clean and elegant- A touch control LED display lets you easily to set precise cooking times and temperatures_________________________________________PLEASE NOTE:ELECTRICAL INSTALLATION: This product requires professional installation to a dedicated circuit by a qualified installer, such as one of our Tech Experts. Our expert installers may be able to install to a dedicated cooker circuit (identified by a big red cooker switch) if you do not have a 16 Amp supply in your home.
"1 to 3 days"
£329.00
Shipping: £45.00
Currys
Hisense BID95211XUK Built In Double Electric Oven - S/Steel 3364664
This Hisense Built In Double Electric Oven offers ample cooking space with a 72l main fan oven and a 38l second cavity featuring a full-width grill, letting you roast a family dinner in one and prepare cheese on toast or gratins in the other. The main fan oven heats evenly and efficiently, ensuring batch bakes and roasts come out crispy outside and tender inside. The second multifunction oven doubles as a grill, perfect for golden lasagne tops or quick snacks without using the main cavity. With a touch LED display and dial controls, adjusting temperatures and timers is simple, and the programmable timer lets you set cooking in advance. Both cavities have easy-clean enamel interiors, interior lights, and double-glazed doors to retain heat. It includes 5 shelves for the main oven, 3 for the second, and a grill tray. Measuring 88cm tall and 59.4cm wide, it fits under your worktop or at eye level, requires hardwiring into a cooker point, and comes with a 2-year manufacturer's guarantee. Both cavities are A-rated for energy efficiency, with the main using 0.81kWh and the second 0.71kWh. Double Oven - Boosting an XL capacity of 72/38L, the main electric fan oven gives you fast and efficient cooking, heating food evenly so that everything you cook is perfectly done – crispy on the outside, juicy on the inside. What's more the second electric oven has a useful grill setting, which gives food a deliciously crispy top. Overview:Digital clock. Programmable digital display timer. LED display. Door window glazing: double glazed. Defrost function. Dial control. Front mounted controls. Main cavity:Fan oven cavity with 5 shelves. 72 litre capacity. Interior light. Main cavity door hinge position: bottom. Easy-clean enamel. Easy clean interior. Energy efficiency rating A. Energy consumption 0.81kWh. Second cavity:Multifunction oven & grill cavity with 3 shelves. 38 litre capacity. Interior light. Door hinge position: bottom. Easy-clean enamel. Easy clean interior. Energy efficiency rating A. Energy consumption 0.71kWh. Grill:Electric (full width) grill. Combined with top oven. Grill tray included (no handle). Dimensions:Oven size H88, W59.4, D56.3cm. Oven to fit aperture (space required H88, W59.4, D56.3cm). Fits in eye level worktop. Fits under worktop. General information:Oven needs to be hard wired into a cooker point on the wall and on its own circuit. Manufacturer's 2 year guarantee. EAN: 3838782434532.
3 to 5 day
£369.00
Shipping: £9.95
Argos
Hisense BID75211BGUK Built Under Double Electric Oven-Black 4721172
This Hisense Built Under Double Electric Oven suits larger households or hosts, with a 54l main cavity and 38l second oven to roast and grill at different temperatures without kitchen chaos. The main fan oven circulates heat evenly for faster, efficient cooking, while the second oven doubles as a full-width grill for crispy toppings or golden cheese. The LED touch display and dial controls make adjusting temperatures and times simple, and grease-proof enamel liners mean a quick wipe is usually all the cleaning needed. Both cavities come with interior lights and double-glazed doors to keep heat in and your kitchen comfortable, plus there's a defrost function for when you've forgotten to take something out of the freezer. It includes 5 shelves in the main oven, 3 in the second, and a grill tray. The oven fits under your worktop or at eye level, needs hardwiring into a cooker point, and slots into a 56cm wide aperture. Both cavities have A energy ratings, with the main using 0.77kWh and the second 0.68kWh, and it's backed by a 2-year manufacturer's guarantee. Double Oven - Boosting an XL capacity of 54/38L, the main electric fan oven gives you fast and efficient cooking, heating food evenly so that everything you cook is perfectly done – crispy on the outside, juicy on the inside. What's more the second electric oven has a useful grill setting, which gives food a deliciously crispy top. Overview:Digital clock. Programmable digital display timer. LED display. Door window glazing: double glazed. Defrost function. Dial control. Front mounted controls. Main cavity:Fan oven cavity with 5 shelves. 54 litre capacity. Interior light. Main cavity door hinge position: bottom. Easy-clean enamel. Easy clean interior. Energy efficiency rating A. Energy consumption 0.77kWh. Second cavity:Multifunction oven & grill cavity with 3 shelves. 38 litre capacity. Interior light. Door hinge position: bottom. Easy-clean enamel. Easy clean interior. Energy efficiency rating A. Energy consumption 0.68kWh. Grill:Electric (full width) grill. Combined with top oven. Grill tray included (no handle). Dimensions:Oven size H72, W59.4, D56.3cm. Oven to fit aperture (space required H72, W56, D55cm). Fits in eye level worktop. Fits under worktop. General information:Oven needs to be hard wired into a cooker point on the wall and on its own circuit. Manufacturer's 2 year guarantee. EAN: 3838782434549.
3 to 5 day
£504.00
Shipping: Free
Argos
Multifunctional Electric Oven 220V 1200W Roaster Comfortable Detachable Cooker
Main Features: - Simple operation, dual knob zone temperature control - Uniform heating, double U-shaped heating pipe, elliptical heating plate -...
£225.42
Shipping: £3.85
OnBuy
Beko AeroPerfect BBAIF22300X Single Electric Oven - S Steel 8384735
This Beko Built In Single Oven features AeroPerfect technology, using constant airflow to keep temperatures steady and cooking even. Whether roasting a joint or baking brownies, everything cooks consistently. With a 66l capacity and fan heating, it handles big family meals and batch cooking easily. The LED timer display and touch controls simplify tracking cooking times and adjusting settings, while the True Fan Cooking function ensures roasts brown perfectly and desserts bake evenly on every shelf. Inside, the easy-clean enamel interior and SimplySteam function make maintenance simple. Pour water into the tray and steam softens burnt-on food and grease, saving scrubbing. It includes 2 shelves, a full-width electric grill, grill tray, interior light, and a double-glazed door with removable inner glass for easier cleaning. The oven fits standard 60cm apertures (H59.5, W59.4, D56.7cm) and requires hardwiring into a cooker point. With an A energy rating at 0.79kWh consumption and a 2-year manufacturer's guarantee, it's a reliable choice for everyday cooking. True Fan Cooking: Always achieve perfectly roasted meat and evenly baked desserts with True Fan Cooking in Beko ovens. Overview:Digital clock. Programmable digital display timer. LED display. Door window glazing: double glazed. Defrost function. Touch control. Front mounted controls. Main cavity:Fan oven cavity with 2 shelves. 66 litre capacity. Interior light. Main cavity door hinge position: bottom. Easy-clean enamel. Easy clean interior. Removable inner glass door for easy cleaning. Energy efficiency rating A. Energy consumption 0.79kWh. Grill:Electric (full width) grill. Combined with oven. Grill tray included (no handle). Dimensions:Oven size H59.5, W59.4, D56.7cm. Oven to fit aperture (space required H60, W56, D55cm). Fits in eye level worktop. General information:Oven needs to be hard wired into a cooker point on the wall and on its own circuit. Manufacturer's 2 year guarantee. EAN: 8690842401527.
3 to 5 day
£240.00
Shipping: £9.95
Argos
Hotpoint HO235HXUK Built In Single Electric Oven - S/Steel 7722477
This Hotpoint Built In Single Oven makes family cooking straightforward, with a generous 71l capacity and 5 multifunction settings that cover everything from fan-assisted baking to full-width grilling. Multiflow technology spreads heat evenly across 3 levels, so you can cook a roast, veg and pudding all at once without flavour transfer or hot spots. The Turbo Grill delivers crisp finishes on gratin tops and melted cheese, while the defrost function makes prep easier when you're short on time. Inside, Diamond Clean uses steam to soften baked-on residue so you can wipe it away without scrubbing or chemicals, and the Click & Clean door removes with a simple press for hassle-free access to every corner. The double-glazed door keeps heat in and your kitchen cooler, and the digital clock with minute minder timer keeps you on track. It comes with 2 shelves, an interior light, and dial controls, plus it fits standard 60cm apertures for built-in or eye-level installation. With 0.81kWh consumption, it arrives with a UK plug attached and a 10-year parts guarantee. Multiflow - Hotpoint's Multiflow technology ensures a precise and consistent temperature across every shelf, so every dish is cooked to perfection—no matter where it's placed. With the ability to cook on up to three levels simultaneously, you'll enjoy effortless efficiency. Overview:Digital clock. Minute minder timer. Door window glazing: double glazed. Defrost function. Dial control. Front mounted controls. Main cavity:Multifunction oven cavity with 2 shelves. 71 litre capacity. Interior light. Main cavity door hinge position: bottom. Easy clean interior. Energy efficiency rating A. Energy consumption 0.81kWh. Grill:Electric (full width) grill. Combined with oven. Dimensions:Oven size H59.5, W59.5, D55.1cm. Oven to fit aperture (space required H60, W56, D55.5cm). Fits in eye level worktop. General information:Oven comes with a 3-pin plug attached that goes into a socket in the wall. Manufacturer's 10 year parts and 1 year labour guarantee. EAN: 5054645705863.
3 to 5 day
£374.00
Shipping: Free
Argos
GreenZech Electric Oven 12L Multifunction Mini Countertop Oven for Bread Cake Baking
Main Features: -The quartz heating tube is used to heat up the upper and lower layers at the same time, so that the food is evenly heated. -There is...
£140.15
Shipping: Free
OnBuy
AEG Built-In Double Electric Oven Fan Oven S/Steel DEX33111EM
Diamond-glazedEnamelInterior:Asmoothenamelinteriorforeaseofcleaning,cookingresiduescanbeeasilywipedawayimmediatelyaftercooking.
£479.00
Shipping: Free
OnBuy
Mini Oven with Timer and KeepWarm, 2in1 Countertop Electric Oven for Baking and Heating, Black
efficiency 220W power: This electric mini oven combines baking, heating and keeping warm functions in one compact unit, enabling fast and reliable...
£191.19
Shipping: Free
OnBuy
Karinear Electric Oven 65L Built in Oven 60cm Wide Knob Control wtih 5 Oven
Karinear Electric Oven 65L Built in Oven 60cm Wide Knob Control wtih 5 Oven is designed to provide convenience, performance, and style for everyday...
£411.11
Shipping: Free
OnBuy
Montpellier MDOC60FW 600mm Double Electric Oven Ceramic Hob Fan Oven White
Montpellier MDOC60FW 600mm Double Electric Oven Ceramic Hob Fan Oven White CATALYTIC LINERS FOR EASY CLEANING: Effortlessly maintain a clean oven...
£616.18
Shipping: Free
OnBuy
Microwave Oven Rack Wall Mount Organizer Easy Install Electric Oven Holder 50cm Argent
Easy Installation A wall mounted microwave oven holder shelf that makes setup straightforward. Install together with family to save time and ensure...
£140.30
Shipping: Free
OnBuy
Klarstein Verosteel BuiltIn Oven 60 cm â 67 L Electric Oven 8 Cooking Modes
Klarstein Verosteel BuiltIn Oven 60 cm - 67 L Electric Oven 8 Cooking Modes is a premium-quality product designed for reliable everyday performance.
£507.34
Shipping: £3.95
OnBuy
Montpellier 600mm Double Electric Oven Induction Hob Fan Oven Black MDOI60FK
Montpellier 600mm Double Electric Oven Induction Hob Fan Oven Black MDOI60FK, Home, Furniture & DIY > Appliances > Cookers, Ovens & Hobs > Cookers
£699.00
Shipping: Free
eBay - electricaldiscountuk
Karinear Electric Oven 65L Built in Oven 60cm Wide Knob Control wtih 5
Karinear Electric Oven 65L Built in Oven 60cm Wide Knob Control wtih 5 Functions 2200W Plug ande Play Oven 220V Large capacity design - 65L electric...
£282.34
Shipping: £2.99
OnBuy
Montpellier MDOC60FW 600mm Double Electric Oven Ceramic Hob Fan Oven White
CATALYTIC LINERS FOR EASY CLEANING: Effortlessly maintain a clean oven with catalytic liners that absorb and break down grease, making cleaning a breeze. DOUBLE OVEN FOR VERSATILE COOKING: Enjoy flexibility in your cooking with a double oven design, allowing you to simultaneously cook different dishes at varying temperatures. SEMI-AUTOMATIC PROGRAMMABLE TIMER: Take control of your cooking with a semi-automatic programmable timer, ensuring precision and convenience for your culinary creations. SPACIOUS 60CM WIDTH: Maximize cooking space with a generous 60cm width, providing ample room for preparing meals and accommodating various cookware. 2-YEAR GUARANTEE AND A/A ENERGY RATING: Experience peace of mind with a 2-year guarantee while enjoying energy efficiency with an impressive A/A energy rating for cost-effective and sustainable cooking.
£419.00
Shipping: Free
Energy Rating: A/A
Amazon Marketplace - Electrical Discount UK - UK MAINLAND DELIVERY ONLY
Montpellier 500mm Double Electric Oven Ceramic Hob Fan Oven White MDOC50FW
Montpellier 500mm Double Electric Oven Ceramic Hob Fan Oven White MDOC50FW, Home, Furniture & DIY > Appliances > Cookers, Ovens & Hobs > Cookers
£399.00
Shipping: Free
eBay - electricaldiscountuk
Montpellier MDOC60FW 600mm Double Electric Oven Ceramic Hob Fan Oven White
MDOC60FW 600mm Double Electric Oven Ceramic Hob Fan Oven White, Home, Furniture & DIY > Appliances > Cookers, Ovens & Hobs > Cookers
£419.00
Shipping: Free
eBay - electricaldiscountuk
Montpellier 600mm Double Electric Oven Ceramic Hob Fan Oven Silver MDOC60FS
Montpellier 600mm Double Electric Oven Ceramic Hob Fan Oven Silver MDOC60FS, Home, Furniture & DIY > Appliances > Cookers, Ovens & Hobs > Cookers
£439.00
Shipping: Free
eBay - electricaldiscountuk
Montpellier 500mm Double Electric Oven Ceramic Hob Fan Oven Silver MDOC50FS
Montpellier 500mm Double Electric Oven Ceramic Hob Fan Oven Silver MDOC50FS, Home, Furniture & DIY > Appliances > Cookers, Ovens & Hobs > Cookers
£399.00
Shipping: Free
eBay - electricaldiscountuk
HOMCOM 10L Air Fryer Oven, Electric Oven, Grill, Roast, Bake, 1000W, Black
...
£50.99
Shipping: Free
OnBuy
SMEG SF6200TBI Musa Electric Oven - Black, Black 10299586
Enjoy perfectly cooked meals every time with this Smeg electric oven. Its Circulaire function keeps the air clean as you're cooking to stop flavours and odours from mixing. That means you won't have to worry about your roast tasting like a grilled fish. Plus, it's a multifunction oven, which means it's got loads of cooking programs to choose from. And the Vapor Clean function uses steam to soften and lift dirt and grease. All that's left to do is give it a quick wipe and you're done.Good to know- The fan blows hot air around the whole oven for fast, even cooking- Its 70-litre capacity is big enough for family dinners or get-togethers- The enamel coating on the inside can easily be wiped off using a damp cloth- Its removable glass door makes it easy to give it a deep clean- The DigiScreen LED display is easy to see, even from the other side of the kitchen_________________________________________PLEASE NOTE:ELECTRICAL INSTALLATION: This product requires professional installation to a 13 Amp fused spur by a qualified installer, such as one of our Tech Experts.
"1 to 3 days"
£399.00
Shipping: £45.00
Currys
Indesit DII10DB Built In Double Electric Oven - Black 7769052
This Indesit Built In Double Oven handles everything from family roasts to weeknight dinners without making you choose. With a 69l main cavity and a 36l top oven, you can run both at once. Perfect for beef in one and pudding in the other. The main oven uses fan circulation for even cooking, while the top cavity works as a conventional oven or full-width grill, with the option to use half the grill for a few rashers. The programmable timer lets you set start and finish times, so dinner's ready when you walk in, and the LED display keeps controls clear and simple to adjust. Both cavities have easy-clean enamel interiors that prevent grease buildup, double-glazed doors to retain heat, and interior lights to check progress without losing temperature. It includes 2 shelves in the main oven, 1 in the top, plus a grill tray and handle. Front-mounted dial controls feature a defrost function for forgotten meals and a child lock for safety. It requires hardwiring into a cooker point, fits eye level or under worktop with a 56cm wide aperture, and both cavities have A energy ratings at 0.79kWh and 0.74kWh. Comes with a 10-year parts and 1-year labour guarantee. Enamel Liners in Both Cavities - The smooth enamel coating in our double ovens stops grease and grime from sticking, making your regular clean-up quick and easy. Overview:Digital clock. Programmable digital display timer. LED display. Door window glazing: double glazed. Defrost function. Dial control. Front mounted controls. Main cavity:Fan oven cavity with 2 shelves. 69 litre capacity. Interior light. Main cavity door hinge position: bottom. Easy-clean enamel. Easy clean interior. Energy efficiency rating A. Energy consumption 0.79kWh. Second cavity:Conventional oven cavity with 1 shelf. 36 litre capacity. Interior light. Door hinge position: bottom. Easy-clean enamel. Easy clean interior. Energy efficiency rating A. Energy consumption 0.74kWh. Grill:Electric (full width) grill. Combined with top oven. Grill tray and handle included. Dimensions:Oven size H89, W59.4, D56.7cm. Oven to fit aperture (space required H87.5, W56, D55cm). Fits in eye level worktop. General information:Oven needs to be hard wired into a cooker point on the wall and on its own circuit. Child lock. Manufacturer's 10 year parts and 1 year labour guarantee. EAN: 8050147712573.
3 to 5 day
£474.00
Shipping: Free
Argos
English Electric Oven Base Bottom Element Genuine C00233876-5
English Electric Oven Base Bottom Element Genuine, Home, Furniture & DIY > Appliances > Cookers, Ovens & Hobs > Cooking Appliance Parts
£77.30
Shipping: Free
eBay - shop4spares
AEG SurroundCook BEX335011B Electric Oven - Black, Black 10261433
Take your baking from bland to grand with this AEG oven. The SurroundCook convection system blows hot air around the whole oven, so every meal is cooked evenly. Thanks to its fan technology, you'll get a perfect golden brown finish on your pies and roasts - every part of your dish gets the heat it needs. You can also bake large batches of sweet treats with its XL baking tray that is 20% larger than the usual ones. And finally, when you're done, Aqua Clean makes it effortless to wipe away those greasy residues using steam - no elbow grease required. Good to know - The Hot Air convection is so efficient that the oven heats up really quickly, saving you time and energy - The LED display with touch control gives you quick access to all the cooking functions - Cook the perfect cheese on toast or crispy bacon in the full width grillLoved by Currys ""Your dishes won't be spoiled by burnt edges or raw middles in this oven. Its SurroundCook convection system makes sure that hot air spreads evenly throughout the oven cavity. So, your food will be cooked perfectly."" - Chris, Product Copywriter _________________________________________ PLEASE NOTE: ELECTRICAL INSTALLATION: This product requires professional installation to a 13 Amp fused spur by a qualified installer, such as one of our Tech Experts.
"1 to 3 days"
£329.00
Shipping: £45.00
Currys
AEG BEX335011B Built In Single Electric Oven - Black 2154291
This AEG Built In Single Oven handles weeknight roasts to weekend baking with a 72l capacity, perfect for family meals and batch cooking. The multifunction design covers fan-assisted cooking, full-width grilling, and more, so you're set for lasagne or trays of cookies. The XL baking tray is 20% larger than standard, offering more space for biscuits, brownies or any bake, cooked evenly thanks to consistent heat distribution. The clear LED timer lets you set alarms, check remaining time, and adjust with precision. With dial controls, a double-glazed door, and easy-clean enamel interior, it fits into your kitchen setup and routine without complication. It needs hardwiring into a cooker point, fits standard 60cm apertures at H60, W56, D55cm and comes with 3 shelves, a grill tray and handle, plus an interior light. At A-rated energy efficiency and 0.93kWh consumption, it's backed by a 2-year manufacturer's guarantee. Get evenly cooked food anywhere in the oven. Overview:Digital clock. Minute minder timer. LED display. Door window glazing: double glazed. Dial control. Front mounted controls. Main cavity:Multifunction oven & grill cavity with 3 shelves. 72 litre capacity. Interior light. Main cavity door hinge position: bottom. Easy-clean enamel. Easy clean interior. Energy efficiency rating A. Energy consumption 0.93kWh. Grill:Electric (full width) grill. Combined with oven. Grill tray and handle included. Dimensions:Oven size H59.4, W59.4, D56.9cm. Oven to fit aperture (space required H60, W56, D55cm). General information:Oven needs to be hard wired into a cooker point on the wall and on its own circuit. Manufacturer's 2 year parts and labour guarantee. EAN: 7333394054360.
3 to 5 day
£329.00
Shipping: £9.95
Argos
Hotpoint HO455CBUK Built In Single Electric Oven - Black 7722501
This Hotpoint Built In Single Oven makes everyday cooking straightforward with a 71l capacity for family roasts, batch baking, or weeknight dinners. The multifunction design offers 5 cooking options including fan, grill and defrost, while Multiflow technology circulates heat evenly across 3 shelf levels to cook multiple dishes without flavour transfer. With 28 auto recipes, a programmable digital timer, and simple dial controls, you can set it and forget it. Catalytic liners catch grease and burn it off, and the Click & Clean removable door makes wiping down the easy-clean interior simpler. Inside you'll find 2 shelves, an interior light, and a full-width electric grill, all in a sleek black finish that fits standard 60cm apertures. The double-glazed door locks in heat, and the digital display shows cooking time clearly. It comes with a 3-pin plug for easy wall socket connection, no hardwiring needed, and fits under your worktop or at eye level. Measuring 59.5cm square and 55.1cm deep, it fits standard spaces with an A energy rating at 0.99kWh consumption. Backed by a 10-year parts guarantee and 1-year labour, it's built to last. Multiflow - Hotpoint's Multiflow technology ensures a precise and consistent temperature across every shelf, so every dish is cooked to perfection—no matter where it's placed. With the ability to cook on up to three levels simultaneously, you'll enjoy effortless efficiency. Overview:Digital clock. Programmable digital display timer. Digit display. Door window glazing: double glazed. Defrost function. Dial control. Front mounted controls. Main cavity:Multifunction oven cavity with 2 shelves. 71 litre capacity. Interior light. Main cavity door hinge position: bottom. Catalytic liners. Easy clean interior. Energy efficiency rating A. Energy consumption 0.99kWh. Grill:Electric (full width) grill. Combined with top oven. Dimensions:Oven size H59.5, W59.5, D55.1cm. Oven to fit aperture (space required H60, W56, D55.5cm). Fits in eye level worktop. General information:Oven comes with a 3-pin plug attached that goes into a socket in the wall. Manufacturer's 10 year parts and 1 year labour guarantee. EAN: 5054645705900.
3 to 5 day
£229.00
Shipping: £9.95
Argos
Hisense BI62220ABGUK Built In Single Electric Oven - Black 4464336
This Hisense Built In Single Oven handles everything from weeknight dinners to bigger family meals with a 61l cavity and 7 cooking functions that include fan, defrost and a full-width grill. The fan circulates hot air for even baking, so everything comes out cooked through without hot spots or burnt edges. The touch screen and ergonomic push-in dials make adjustments straightforward, and the LED display with programmable timer means you can set it and forget it. With 4 cooking levels, you can fit multiple dishes in at once - ideal when you're juggling sides and mains. The double-glazed door keeps heat in and the kitchen cooler, while the easy-clean enamel interior and removable inner glass door make post-dinner cleanup much simpler. It includes 1 shelf and an interior light so you can check on progress without opening the door. It fits neatly under your worktop or at eye level, needs hardwiring into a cooker point, and slots into standard 60cm spaces. At A-rated energy efficiency and 0.77kWh consumption, it's backed by a 2-year manufacturer's guarantee. 61L Capacity -With it's spacious 61L capacity, you can cook multiple dishes at once, ideal for family meals and entertaining. Equipped with four cooking levels, perfect for simultaneous cooking. Energy efficient and versatile, this oven enhances your cooking experience while handling large meals with ease. Overview:Digital clock. Digital display timer. LED display. Door window glazing: double glazed. Defrost function. Dial control. Front mounted controls. Main cavity:Fan oven cavity with 1 shelf. 61 litre capacity. Interior light. Main cavity door hinge position: bottom. Easy-clean enamel. Easy clean interior. Removable inner glass door for easy cleaning. Energy efficiency rating A. Energy consumption 0.77kWh. Grill:Electric (full width) grill. Combined with oven. Grill tray not included. Dimensions:Oven size H59.5, W59.5, D53cm. Oven to fit aperture (space required H60, W56, D58cm). Fits in eye level worktop. Fits under worktop. General information:Manufacturer's 2 year guarantee. EAN: 3838782863196.
3 to 5 day
£199.00
Shipping: £9.95
Argos
Hotpoint HO455CBUK Built In Single Electric Oven - Black 7722525
This Hotpoint Built In Single Oven gives you a generous 71l cavity with multifunction cooking, so you can handle everything from family roasts to batch baking across 3 levels without flavours mixing. The Multiflow technology circulates heat evenly throughout the oven, which means consistent results no matter which shelf you're using. With 5 cooking functions including defrost and a full-width grill, plus 28 auto recipes built in, it takes the guesswork out of everyday cooking and gives you plenty of options for whatever's on the menu. The catalytic liners use heat to break down grease while you cook, reducing scrubbing, and the Click & Clean removable door gives easy access for a thorough clean. The programmable digital timer and simple dial controls make it easy to set and adjust, while the double-glazed door keeps heat in and your kitchen cooler. It includes 2 shelves, interior light, and an easy-clean interior, fitting standard 60cm apertures at 59.5cm square. With an A energy rating at 0.99kWh consumption, it plugs into a standard socket and comes with a 10-year parts and 1-year labour guarantee. Multiflow - Hotpoint's Multiflow technology ensures a precise and consistent temperature across every shelf, so every dish is cooked to perfection—no matter where it's placed. With the ability to cook on up to three levels simultaneously, you'll enjoy effortless efficiency. Overview:Digital clock. Programmable digital display timer. Digit display. Door window glazing: double glazed. Defrost function. Dial control. Front mounted controls. Main cavity:Multifunction oven cavity with 2 shelves. 71 litre capacity. Interior light. Main cavity door hinge position: bottom. Catalytic liners. Easy clean interior. Energy efficiency rating A. Energy consumption 0.99kWh. Grill:Electric (full width) grill. Combined with top oven. Dimensions:Oven size H59.5, W59.5, D55.1cm. Oven to fit aperture (space required H60, W56, D55.5cm). Fits in eye level worktop. General information:Oven comes with a 3-pin plug attached that goes into a socket in the wall. Manufacturer's 10 year parts and 1 year labour guarantee. EAN: 5054645705900.
3 to 5 day
£374.00
Shipping: Free
Argos
Hisense BSA66346PDBGUK Built In Single Electric Oven -Black 3364688
This Hisense Built In Single Oven makes family cooking and batch baking effortless, with a 77l capacity and 5 shelf levels to roast, bake and grill simultaneously. Wi-Fi connectivity lets you preheat and monitor meals remotely via the Connect Life app. The multifunction fan offers Air Fry mode for guilt-free chips, Steam Add for perfect bakes, Pizza Mode, and 22 automatic programmes. The full-width electric grill handles everything from melting cheese to veggie skewers, and pyrolytic self-clean turns grease to ash with high heat, reducing scrubbing time. The sleek jet black touch control interface makes navigation easy, with quick-access buttons and a programmable LED timer for on-the-fly adjustments. The quadruple-glazed door locks in heat and keeps your kitchen cooler, while the interior light and removable glass door simplify checking and cleaning. It includes 5 shelves, a grill tray, child lock, and slow cook and defrost functions for flexibility. Fits standard 59.5cm apertures under your worktop or at eye level, requires hardwiring into a cooker point, and has an A energy rating at 1.03kWh. Backed by a 2-year manufacturer's guarantee. Experience steam cooking with Steam Add Plus for perfectly baked goods. Cook up a storm with an array of functions including Air Fry and Pizza Mode or make use of the 22 automatic programmes. Effortless maintenance with Pyrolytic Self-Clean which turns grease and grime to ash by using high heat. Overview:Digital clock. Programmable digital display timer. LED display. Door window glazing: quadruple glazed. Slow cook function. Defrost function. Touch control. Front mounted controls. Main cavity:Multifunction fan oven cavity with 5 shelves. 77 litre capacity. Interior light. Main cavity door hinge position: bottom. Pyrolytic cleaning. Easy clean interior. Energy efficiency rating A+. Energy consumption 1.03kWh. Grill:Electric (full width) grill. Combined with oven. Grill tray included (no handle). Dimensions:Oven size H59.5, W59.5, D66cm. Oven to fit aperture (space required H59.5, W59.5, D56.4cm). Fits in eye level worktop. Fits under worktop. General information:Oven needs to be hard wired into a cooker point on the wall and on its own circuit. Child lock. Wi-Fi. Manufacturer's 2 year guarantee. EAN: 3838782762130.
3 to 5 day
£549.00
Shipping: £9.95
Argos
Refine Search
Filters
Clear All
Category
✓Price
✓Brand
0Seller
0