Sorry, nothing was found. Please change your selection and try again.
Electric Ovens
(801 - 840 of 4,855 results)
Filters
Best Match
Best Match
Price: Low to high
Price: High to low
Electric Oven Rotisserie Rack 1800 W 48L Lafe
Electric Oven Rotisserie Rack 1800 W 48L Lafe, Home, Furniture & DIY > Appliances > Small Kitchen Appliances > Mini Ovens
£139.39
Shipping: Free
eBay - euroelectronics_uk
Genuine BEKO 267440152 Timer Assembly Clock For BEKO Electric Oven
Genuine BEKO 267440152 Timer Assembly Clock For BEKO Electric Oven, Home, Furniture & DIY > Appliances > Cookers, Ovens & Hobs > Cooking Appliance Parts
£99.95
Shipping: Free
eBay - my_appliance_spares
Smeg Cucina Multifunction Electric Oven & Gas Hob Pack CCGASPK
Smeg Cucina Multifunction Electric Oven & Gas Hob Pack CCGASPK, Home, Furniture & DIY > Appliances > Cookers, Ovens & Hobs > Ovens
£657.97
Shipping: Free
eBay - buyitdirectdiscounts
Beko BBIF22100X Single Electric Oven With RecycledNet 8909938
This Beko Built In Single Oven is designed for everyday family cooking, with AeroPerfect technology that keeps airflow constant throughout the 66l cavity so midweek dinners and weekend roasts cook evenly without hot spots. The True Fan system circulates heat for perfectly roasted meat and evenly baked desserts, while the full-width electric grill handles crispy bacon to loaded cheese toasties. SimplySteam makes cleaning easier. Pour water into the tray and steam softens burnt-on grease so you can wipe it away without elbow grease. The easy-clean enamel interior, removable inner glass door, and double-glazed door keep maintenance straightforward, while the analogue clock with minute minder helps you keep track. It includes 2 shelves, a grill tray, interior light, and simple dial controls. The defrost function speeds up ingredient prep. Designed to fit standard 60cm apertures at eye level or under your worktop, it requires hardwiring into a cooker point and comes with a 2-year manufacturer's guarantee. With an A energy rating and 0.79kWh consumption, it handles daily cooking without running up bills. True Fan Cooking: Always achieve perfectly roasted meat and evenly baked desserts with True Fan Cooking in Beko ovens. Overview:Analogue clock. Minute minder timer. No digital display. Door window glazing: double glazed. Defrost function. Dial control. Front mounted controls. Main cavity:Fan oven cavity with 2 shelves. 66 litre capacity. Interior light. Main cavity door hinge position: bottom. Easy-clean enamel. Easy clean interior. Removable inner glass door for easy cleaning. Energy efficiency rating A. Energy consumption 0.79kWh. Grill:Electric (full width) grill. Combined with oven. Grill tray included (no handle). Dimensions:Oven size H59.5, W59.4, D56.7cm. Oven to fit aperture (space required H60, W56, D55cm). Fits in eye level worktop. General information:Oven needs to be hard wired into a cooker point on the wall and on its own circuit. Manufacturer's 2 year guarantee. EAN: 8690842385612.
3 to 5 day
£210.00
Shipping: £9.95
Argos
Haden 60cm Built-in Single Electric Oven, 65 Litre
This Haden 60cm Built-in Single Electric Oven, 65 Litre Capacity, Digital Programmer, HSB65LPIX, A-Rated, Hydrolytic Cleaning is designed to provide...
£289.71
Shipping: Free
OnBuy
Cooksir Built-In Electric Oven 65L with Grill, 2200W
This Cooksir Built-In Electric Oven 65L with Grill, 2200W Single Oven with 13amp Plug, 60cm Installed ovens, 4 Functions, 6 Shelves, Removable Door...
£277.94
Shipping: Free
OnBuy
Kaiser Empire Single Electric Oven - Black EH 6355 EM
The Empire EH 6355 Em is a 63-litre electric oven, finished in an enamelled black for a vintage look and style. Designed to make cooking easy, with...
£728.10
Shipping: Free
OnBuy
CDA Electric Single Oven - Black
CDA Electric Single Oven - Black
£368.98
Shipping: £14.95
Amazon Marketplace - Buy It Direct LTD
AAKOMA Durable Electric Oven Holder Shelf, 1 Shelf, Rectangular, Minimalist Style, Gun Gray, 60 cm, Wall-Mounted, Suitable for Electric Oven, Microwave Oven/Gun, 1 Count R00040
AAKOMA Durable Electric Oven Holder Shelf, 1 Shelf, Rectangular, Minimalist Style, Gun Gray, 60 cm, Wall-Mounted, Suitable for Electric Oven, Microwave Oven/Gun, 1 Count
£58.36
Shipping: Free
Amazon Marketplace - shangnongjiatingnongchang
Klarstein Victoria Pyro Electric Oven 76L Built In Oven Retro Design 11 Mo
Klarstein Victoria Pyro Electric Oven 76L Built In Oven Retro Design 11 Mo is a premium-quality product designed for reliable everyday performance.
£898.50
Shipping: £3.95
OnBuy
Various Specifications Of Mini Electric Ovens: The Small Ovens In Student Dormitories Are Very Small And Easy To Move (Black)
This multifunctional breakfast table offers you a complete breakfast, toast + omelette, which can be cooked at the same time or individually This...
£69.73
Shipping: Free
OnBuy
Kaiser Avantgarde Pro EH 6337 Oven | Single Electric Oven with Pyrolytic Self Cleaning Technology
MULTI 11 FUNCTION - A single electric oven, with 11 operating choices. PYROLYTIC SELF-CLEAN FUNCTION - Fast cleaning technology. The temperature rises up to 400 °C for an hour to provide permanent and convenient cleaning of even the hardest to reach places. No need for additional scrubbing! EASY CLEAN INTERIOR - Don't want to use the Pyrolytic function? No problem! The interior of the oven is coated with an easy clean enamel. This enamel is antiallergic, antibacterial, hygienic, durable & environmentally friendly. EASY FIT SHELF SUPPORT RAILS - The shelf support rails are made of stainless steel. You can pull out baking trays and wire shelves without any damage to the enamel. The side rails can be easily dismantled which ensures convenient cleaning of the oven cavity. The shelf support rails can be washed by hand or simply put in the dishwasher for ultra convenient cleaning. HOT AIR SYSTEM - Fan-assisted cooking that reduces cooking time, both time and energy saving! The oven temperature can be set to 50° – 280°C which is ideally suited for baking cakes and biscuits, with even distribution of heat throughout the cavity. DOUBLE INFRARED GRILL - Situated at the top of the oven cavity and perfect for toast (and more of course!). INTERNAL FOOD PROBE - Insert the probe into your chosen food and set the oven to cook to the correct core temperature needed for the perfect result. Fantastic for baking, and perfect for roast dinners! DEFROST FUNCTION - By selecting one of the fan cooking functions and setting the temperature regulator to zero, the fan allows cold air to circulate inside the oven. In this way frozen food can be rapidly defrosted. KAISER INTELLIGENT SYSTEM CONTROLS - An electronic sensore control, eith electronic programmer, electronic timer & digital display unit. Easy to use and control all cooking options.
£917.10
Shipping: Free
Amazon Marketplace - Kaiser Appliances
Klarstein Victoria Pyro Electric Oven - 76L Built In Oven, Retro Design, 11 Mode
Bring a touch of vintage glamour to your kitchen with the Klarstein Victoria Pyro 60â¯cm Electric Oven-where classic Victorian style meets...
£987.81
Shipping: £3.99
OnBuy
Hoover Built In Electric Single Oven - Black - A++ Rated
hOn app — Control your oven from your phone Smart-connected — Compatible with Alexa and Google Home Touch Control — Easily change the settings with a tap Soft closing door — Put an end to accidental slams Hydro Easy Clean — Steam loosens burnt-on food spills
£699.00
Shipping: £14.95
Energy Rating: A++
Amazon Marketplace - AO
Statesman Electric Pizza Oven PYDD1122
Introducing the Statesman 13 Inch Electric Pizza Oven, your ultimate kitchen companion for perfect pizzas! With a 100~500℃ temperature range, precise temperature control, and timer, enjoy effortless cooking with the digital display. The 330 x 330mm cooking area, 13-inch pizza stone, oven door and handle, dual heating elements, and included utensils (pizza cutter, pizza slice, brush) ensure every pizza is a masterpiece. Upgrade your pizza game today! Statesman
£213.99
Shipping: Free
Wayfair UK
Beko RecycledNet Built In Electric Double Oven -
This Beko RecycledNet Built In Electric Double Oven - Stainless Steel - A/A Rated is designed to provide reliable performance and practical everyday...
£505.81
Shipping: Free
OnBuy
Hotpoint Built In Electric Single Oven - Stainless
This Hotpoint Built In Electric Single Oven - Stainless Steel - A+ Rated is designed to provide reliable performance and practical everyday use.
£527.94
Shipping: Free
OnBuy
Hotpoint Built In Electric Single Oven - Stainless
This Hotpoint Built In Electric Single Oven - Stainless Steel - A+ Rated is designed to provide reliable performance and practical everyday use.
£689.71
Shipping: Free
OnBuy
Beko Electric Single Oven with Steam Cleaning -
This Beko Electric Single Oven with Steam Cleaning - Stainless Steel is designed to provide reliable performance and practical everyday use. Built...
£522.22
Shipping: Free
OnBuy
Hotpoint Built In Electric Single Oven - Black - A+ Rated
Hotpoint Built In Electric Single Oven - Black - A+ Rated LARGE CAPACITY - 88L Capacity (31L Top Cavity / 57L Lower Cavity) and consistent...
£633.88
Shipping: £3.59
OnBuy
Hoover Built In Electric Single Oven - Black - A++ Rated
hOn app — Control your oven from your phone Smart-connected — Compatible with Alexa and Google Home Touch Control — Easily change the settings with a tap Soft closing door — Put an end to accidental slams Hydro Easy Clean — Steam loosens burnt-on food spills Hydrolytic & Pyrolytic — Self-cleaning settings Air Fry Mode — Special setting cooks healthy food
£549.00
Shipping: £14.95
Energy Rating: A++
Amazon Marketplace - AO
GreenZech Electric Oven 12L Multifunction Mini Countertop Oven for Bread Cake Baking
Main Features: -The quartz heating tube is used to heat up the upper and lower layers at the same time, so that the food is evenly heated. -There is...
£140.15
Shipping: Free
OnBuy
AEG Built-In Double Electric Oven Fan Oven S/Steel DEX33111EM
Diamond-glazedEnamelInterior:Asmoothenamelinteriorforeaseofcleaning,cookingresiduescanbeeasilywipedawayimmediatelyaftercooking.
£479.00
Shipping: Free
OnBuy
Mini Oven with Timer and KeepWarm, 2in1 Countertop Electric Oven for Baking and Heating, Black
efficiency 220W power: This electric mini oven combines baking, heating and keeping warm functions in one compact unit, enabling fast and reliable...
£191.19
Shipping: Free
OnBuy
Samsung Dual Cook Electric Oven - Stainless Steel NV7B44205AS
Samsung Dual Cook Electric Oven - Stainless Steel
£387.00
Shipping: Free
Energy Rating: A+
Amazon Marketplace - Crampton And Moore
YKMYXZ kitchen organizer， Wall-Mounted Electric Oven Holder Shelf Durable QZGGXXQXX
Made from carbon steel and finished with a baked enamel coating, the stand is sturdy and durable.
£105.20
Shipping: Free
Amazon Marketplace - YKMYXZ
YKMYXZ kitchen organizer， Wall-Mounted Electric Oven Holder Shelf Durable QZGGXXTXX
Made from carbon steel and finished with a baked enamel coating, the stand is sturdy and durable.
£122.19
Shipping: Free
Amazon Marketplace - YKMYXZ
YKMYXZ kitchen organizer， Durable Electric Oven Holder Shelf Suitable For, Microwave QZGGXVBAA
Made from carbon steel and finished with a baked enamel coating, the stand is sturdy and durable.
£104.94
Shipping: Free
Amazon Marketplace - YKMYXZ
YKMYXZ kitchen organizer， Wall-Mounted Electric Oven Holder Shelf Durable QZGGXXTVZ
Made from carbon steel and finished with a baked enamel coating, the stand is sturdy and durable.
£120.93
Shipping: Free
Amazon Marketplace - YKMYXZ
YKMYXZ kitchen organizer， Electric Oven Holder Shelf Durable ShelfSuitable For, Microwave QZGGXVHGO
Made from carbon steel and finished with a baked enamel coating, the stand is sturdy and durable.
£106.39
Shipping: Free
Amazon Marketplace - YKMYXZ
YKMYXZ kitchen organizer， Wall-Mounted Electric Oven Holder Shelf Durable QZGGXXVTV
Made from carbon steel and finished with a baked enamel coating, the stand is sturdy and durable.
£105.20
Shipping: Free
Amazon Marketplace - YKMYXZ
Indesit DUI10DB Built Under Double Electric Oven - Black 7723232
This Indesit Built Under Double Oven handles weekday meals and family feasts with a 48l main fan oven and 36l conventional top oven, letting you roast chicken and bake crumble at different temperatures. The Twin Grill offers half or full width to match your cooking needs. The programmable timer and clear LED display make setting times easy. The smooth easy-clean enamel coating means grease wipes away quickly, and the Steam&Clean function loosens stubborn bits so you're not stuck scrubbing for hours. Both cavities come with interior lights and double-glazed doors to keep heat in, plus there's a slow cook function and defrost mode when you need them. With dial controls, 2 shelves in the main oven and 1 in the top, it fits under your worktop and needs hardwiring into a cooker point. The main oven uses 0.72kWh and the top 0.74kWh, both rated A for energy efficiency. It measures 71.5cm high by 59.4cm wide, fits a 55.5cm aperture, and backed by a 10-year parts and 1-year labour warranty. Twin Grill - Choose either a half or full grill. Overview:Digital clock. Programmable digital display timer. LED display. Door window glazing: double glazed. Slow cook function. Defrost function. Dial control. Front mounted controls. Main cavity:Fan oven cavity with 2 shelves. 48 litre capacity. Interior light. Main cavity door hinge position: bottom. Easy-clean enamel. Easy clean interior. Energy efficiency rating A. Energy consumption 0.72kWh. Second cavity:Conventional oven cavity with 1 shelf. 36 litre capacity. Interior light. Door hinge position: bottom. Easy-clean enamel. Easy clean interior. Energy efficiency rating A. Energy consumption 0.74kWh. Grill:Electric (full width) grill. Combined with top oven. Dimensions:Oven size H71.5, W59.4, D57.5cm. Oven to fit aperture (space required H71.7, W55.5, D56cm). Fits under worktop. General information:Oven needs to be hard wired into a cooker point on the wall and on its own circuit. Manufacturer's 10 year parts and 1 year labour guarantee. EAN: 8050147712658.
3 to 5 day
£454.00
Shipping: Free
Argos
AEG BEX335011M Built In Single Electric Oven - S/Steel 2154033
This AEG Built In Single Oven offers a 72l cavity that handles everything from weeknight roasts to full trays of biscuits with ease. The SurroundCook convection system circulates hot air for golden, evenly cooked results whether baking pastry or roasting chicken. The XL baking tray is 20% larger than standard, fitting more yorkshires, cookies or whatever you're making, all cooked evenly. The LED display and digital clock let you set the minute minder timer, check remaining time, and adjust as needed. With dial controls, double-glazed door, and easy-clean enamel interior, it's built to fit into your routine without any fuss. It's a multifunction oven with grill, comes with 3 shelves and an interior light, and has a full-width electric grill combined with the oven for flexibility. Hardwiring into a cooker point is required, and it fits standard apertures at 59.4cm square. At A-rated energy efficiency and 0.93kWh consumption, it's backed by a 2-year parts and labour guarantee. Get evenly cooked food anywhere in the oven. Overview:Digital clock. Minute minder timer. LED display. Door window glazing: double glazed. Dial control. Front mounted controls. Main cavity:Multifunction oven & grill cavity with 3 shelves. 72 litre capacity. Interior light. Main cavity door hinge position: bottom. Easy-clean enamel. Easy clean interior. Energy efficiency rating A. Energy consumption 0.93kWh. Grill:Electric (full width) grill. Combined with oven. Dimensions:Oven size H59.4, W59.4, D56.9cm. Oven to fit aperture (space required H60, W56, D55cm). General information:Oven needs to be hard wired into a cooker point on the wall and on its own circuit. Manufacturer's 2 year parts and labour guarantee. EAN: 7333394054377.
3 to 5 day
£515.00
Shipping: £9.95
Argos
Indesit DII10DIX Built In Double Electric Oven - S/Steel 7713606
Cooking family feasts or quick weekday meals is easy with this Indesit built-in double oven. It features a roomy 69L main oven and a 36L top oven, all in a sleek stainless steel design with a clear digital display. The Twin Grill lets you use the full or half grill to save energy when cooking smaller portions. A programmable timer alerts you when food's ready, so no need to keep checking. Plus, the smooth enamel coating makes cleaning quick and easy—more time to enjoy with the family. Enamel Liners in Both Cavities - The smooth enamel coating in our double ovens stops grease and grime from sticking, making your regular clean-up quick and easy. Digital Display - The Digital Display simplifies cooking with a range of time settings to match your dish. Whether you're baking, roasting, or grilling, you can easily choose the right duration for your recipe. This intuitive feature gives you control, ensuring your cooking is always just as you intended. Programmable Timer - The handy programmable timer lets you set how long you want your oven to cook, or it can calculate when the cooking should start by setting the time you need it to finish. Either way, your meals will be ready when you are. Overview:Digital clock. Programmable digital display timer. LED display. Door window glazing: double glazed. Defrost function. Dial control. Front mounted controls. Main cavity:Fan oven cavity with 2 shelves. 69 litre capacity. Interior light. Main cavity door hinge position: bottom. Easy-clean enamel. Easy clean interior. Energy efficiency rating A. Energy consumption 0.79kWh. Second cavity:Conventional oven cavity with 1 shelf. 36 litre capacity. Interior light. Door hinge position: bottom. Easy-clean enamel. Easy clean interior. Energy efficiency rating A. Energy consumption 0.74kWh. Grill:Electric (full width) grill. Combined with top oven. Grill tray and handle included. Dimensions:Oven size H89, W59.4, D56.7cm. Oven to fit aperture (space required H87.5, W56, D55cm). Fits in eye level worktop. General information:Oven needs to be hard wired into a cooker point on the wall and on its own circuit. Child lock. Manufacturer's 10 year parts and 1 year labour guarantee. EAN: 8050147712535.
3 to 5 day
£474.00
Shipping: Free
Argos
Hotpoint DIH10DIX Built In Double Electric Oven - S/Steel 7743535
This Hotpoint Built In Double Oven offers flexible cooking with a 75l fan oven and 38l conventional top oven, letting you roast a chicken while grilling vegetables or baking dessert at different temperatures. The main cavity uses fan-assisted heat with 3 shelves, while the top oven serves as a full-width grill with a half-width energy-saving option. The programmable digital timer and LED display simplify timing and alerts. Easy-clean enamel liners reduce scrubbing. With slow cook, defrost functions, and dial controls, it handles everything from weeknight dinners to weekend roasts effortlessly. Both cavities have interior lights and double-glazed doors to keep heat in, and they're both A-rated at 0.82kWh for the main oven and 0.68kWh for the top. It comes with a grill tray and handle, and the stainless steel finish fits neatly into a standard 56cm wide aperture for eye-level or built-under installation. Hardwiring into a cooker point is required, and it's backed by a 10-year parts and 1-year labour guarantee. At 89cm tall and 59.4cm wide, it's designed to slot into your kitchen and get on with the job. Enamel Liners in Both Cavities - Hotpoint has your oven cleaning covered with easy to wipe clean enamel liners, so you spend less time cleaning the oven. Overview:Digital clock. Programmable digital display timer. LED display. Door window glazing: double glazed. Slow cook function. Defrost function. Dial control. Front mounted controls. Main cavity:Fan oven cavity with 3 shelves. 75 litre capacity. Interior light. Main cavity door hinge position: bottom. Easy-clean enamel. Easy clean interior. Energy efficiency rating A. Energy consumption 0.82kWh. Second cavity:Conventional oven cavity with 1 shelf. 38 litre capacity. Interior light. Door hinge position: bottom. Easy-clean enamel. Easy clean interior. Energy efficiency rating A. Energy consumption 0.68kWh. Grill:Electric (full width) grill. Combined with top oven. Grill tray and handle included. Dimensions:Oven size H89, W59.4, D56.7cm. Oven to fit aperture (space required H87.5, W56, D55cm). Fits in eye level worktop. General information:Oven needs to be hard wired into a cooker point on the wall and on its own circuit. Manufacturer's 10 year parts and 1 year labour guarantee. EAN: 5054645712601.
3 to 5 day
£524.00
Shipping: Free
Argos
Hotpoint DIH10DIX Built In Double Electric Oven - S/Steel 7850538
Need extra cooking space? This Hotpoint Built-In double oven delivers with a 75L main oven and 38L top oven—perfect for everything from quick meals to family feasts. Its sleek stainless steel finish pairs with an intuitive digital display for a modern, functional design. The Twin Grill lets you use the full surface or just half to save energy. A programmable timer alerts you when your meal's ready, so you can cook with confidence and enjoy delicious results every time. Enamel Liners in Both Cavities - Hotpoint has your oven cleaning covered with easy to wipe clean enamel liners, so you spend less time cleaning the oven. Digital Display - The digital display gives you feedback at a glance, so you can set the timer, and your oven will alert you when your meal is ready. When you're juggling a busy household, our handy programmable timer has your back. Overview:Digital clock. Programmable digital display timer. LED display. Door window glazing: double glazed. Slow cook function. Defrost function. Dial control. Front mounted controls. Main cavity:Fan oven cavity with 3 shelves. 75 litre capacity. Interior light. Main cavity door hinge position: bottom. Easy-clean enamel. Easy clean interior. Energy efficiency rating A. Energy consumption 0.82kWh. Second cavity:Conventional oven cavity with 1 shelf. 38 litre capacity. Interior light. Door hinge position: bottom. Easy-clean enamel. Easy clean interior. Energy efficiency rating A. Energy consumption 0.68kWh. Grill:Electric (full width) grill. Combined with top oven. Grill tray and handle included. Dimensions:Oven size H89, W59.4, D56.7cm. Oven to fit aperture (space required H87.5, W56, D55cm). Fits in eye level worktop. General information:Oven needs to be hard wired into a cooker point on the wall and on its own circuit. Manufacturer's 10 year parts and 1 year labour guarantee. EAN: 5054645712601.
3 to 5 day
£379.00
Shipping: £9.95
Argos
Hotpoint DIH82DIX Built In Double Electric Oven - S/Steel 7722099
This Hotpoint Built In Double Electric Oven offers two ovens with a 71l main cavity and a 38l top oven, letting you roast, bake and grill at different temperatures without timing hassle. With 8 cooking functions including slow cook, defrost and a full-width grill, it suits weeknight dinners and family roasts. Catalytic liners break down grease during cooking, reducing scrubbing. The programmable digital timer and LED display simplify timing and alerts, while double-glazed doors keep heat in and your kitchen cooler. The main oven is multifunction with 2 shelves and interior light; the top oven has 1 shelf plus a full-width grill. Both have easy-clean interiors and catalytic panels. Front-mounted dial controls keep things straightforward, and both ovens are A-rated for energy efficiency at 0.95kWh and 0.68kWh respectively. Designed to fit at eye level or under your worktop in a standard 56cm wide aperture, it needs hardwiring into a cooker point and comes with a 10-year parts and 1-year labour guarantee. At 89cm tall and finished in stainless steel, it's built to handle busy family cooking without drama. Catalytic Liners in Both Cavities - Catalytic liners are special panels that catch fat spits and grease, removing them naturally during the cooking process, so when your passion is cooking, not cleaning, Hotpoint has you covered. Overview:Digital clock. Programmable digital display timer. LED display. Door window glazing: double glazed. Slow cook function. Defrost function. Dial control. Front mounted controls. Main cavity:Multifunction oven cavity with 2 shelves. 71 litre capacity. Interior light. Main cavity door hinge position: bottom. Catalytic liners. Easy clean interior. Energy efficiency rating A. Energy consumption 0.95kWh. Second cavity:Multifunction oven & grill cavity with 1 shelf. 38 litre capacity. Interior light. Door hinge position: bottom. Catalytic liners. Easy clean interior. Energy efficiency rating A. Energy consumption 0.68kWh. Grill:Electric (full width) grill. Combined with top oven. Dimensions:Oven size H89, W59.4, D56.7cm. Oven to fit aperture (space required H87.5, W56, D55cm). Fits in eye level worktop. General information:Oven needs to be hard wired into a cooker point on the wall and on its own circuit. Manufacturer's 10 year parts and 1 year labour guarantee. EAN: 5054645712588.
3 to 5 day
£429.00
Shipping: £9.95
Argos
Refine Search
Filters
Clear All
Category
✓Price
✓Brand
0Seller
0