Sorry, nothing was found. Please change your selection and try again.

Electric Ovens

(801 - 840 of 4,767 results)
Filters
Best Match
AEG Built-In Double Electric Oven Fan Oven S/Steel DEX33111EM
AEG Built-In Double Electric Oven Fan Oven S/Steel DEX33111EM
Diamond-glazedEnamelInterior:Asmoothenamelinteriorforeaseofcleaning,cookingresiduescanbeeasilywipedawayimmediatelyaftercooking.
£479.00
Shipping: Free
Beko Electric Single Oven - Black
Beko Electric Single Oven - Black
AeroPerfect — Evenly sends heat around the oven RecycledNet — Parts are made from recycled materials Pyrolytic self-cleaning — High temps turn grease to ash Touch Control LED Display — easy to read and change
£299.00
Shipping: £14.95
Energy Rating: A
Amazon Marketplace - AO
GreenZech 12L / 800W Mini Electric Kitchen Oven Muti-function Cooking Electric Oven Machine Home Baking Machine
GreenZech 12L / 800W Mini Electric Kitchen Oven Muti-function Cooking Electric Oven Machine Home Baking Machine
Description : 12L / 800W Mini Electric Kitchen Oven Muti-function Cooking Machine Home Baking Machine. -12L Mini Capacity. 12L suitable...
£255.75
Shipping: Free
SMEG SF6200TBI Musa Electric Oven - Black, Black 10299586
SMEG SF6200TBI Musa Electric Oven - Black, Black 10299586
Enjoy perfectly cooked meals every time with this Smeg electric oven. Its Circulaire function keeps the air clean as you're cooking to stop flavours and odours from mixing. That means you won't have to worry about your roast tasting like a grilled fish. Plus, it's a multifunction oven, which means it's got loads of cooking programs to choose from. And the Vapor Clean function uses steam to soften and lift dirt and grease. All that's left to do is give it a quick wipe and you're done.Good to know- The fan blows hot air around the whole oven for fast, even cooking- Its 70-litre capacity is big enough for family dinners or get-togethers- The enamel coating on the inside can easily be wiped off using a damp cloth- Its removable glass door makes it easy to give it a deep clean- The DigiScreen LED display is easy to see, even from the other side of the kitchen_________________________________________PLEASE NOTE:ELECTRICAL INSTALLATION: This product requires professional installation to a 13 Amp fused spur by a qualified installer, such as one of our Tech Experts.
"1 to 3 days"
£399.00
Shipping: £45.00
Indesit DII10DB Built In Double Electric Oven - Black 7769052
Indesit DII10DB Built In Double Electric Oven - Black 7769052
This Indesit Built In Double Oven handles everything from family roasts to weeknight dinners without making you choose. With a 69l main cavity and a 36l top oven, you can run both at once. Perfect for beef in one and pudding in the other. The main oven uses fan circulation for even cooking, while the top cavity works as a conventional oven or full-width grill, with the option to use half the grill for a few rashers. The programmable timer lets you set start and finish times, so dinner's ready when you walk in, and the LED display keeps controls clear and simple to adjust. Both cavities have easy-clean enamel interiors that prevent grease buildup, double-glazed doors to retain heat, and interior lights to check progress without losing temperature. It includes 2 shelves in the main oven, 1 in the top, plus a grill tray and handle. Front-mounted dial controls feature a defrost function for forgotten meals and a child lock for safety. It requires hardwiring into a cooker point, fits eye level or under worktop with a 56cm wide aperture, and both cavities have A energy ratings at 0.79kWh and 0.74kWh. Comes with a 10-year parts and 1-year labour guarantee. Enamel Liners in Both Cavities - The smooth enamel coating in our double ovens stops grease and grime from sticking, making your regular clean-up quick and easy. Overview:Digital clock. Programmable digital display timer. LED display. Door window glazing: double glazed. Defrost function. Dial control. Front mounted controls. Main cavity:Fan oven cavity with 2 shelves. 69 litre capacity. Interior light. Main cavity door hinge position: bottom. Easy-clean enamel. Easy clean interior. Energy efficiency rating A. Energy consumption 0.79kWh. Second cavity:Conventional oven cavity with 1 shelf. 36 litre capacity. Interior light. Door hinge position: bottom. Easy-clean enamel. Easy clean interior. Energy efficiency rating A. Energy consumption 0.74kWh. Grill:Electric (full width) grill. Combined with top oven. Grill tray and handle included. Dimensions:Oven size H89, W59.4, D56.7cm. Oven to fit aperture (space required H87.5, W56, D55cm). Fits in eye level worktop. General information:Oven needs to be hard wired into a cooker point on the wall and on its own circuit. Child lock. Manufacturer's 10 year parts and 1 year labour guarantee. EAN: 8050147712573.
3 to 5 day
£474.00
Shipping: Free
English Electric Oven Base Bottom Element Genuine C00233876-5
English Electric Oven Base Bottom Element Genuine C00233876-5
English Electric Oven Base Bottom Element Genuine, Home, Furniture & DIY > Appliances > Cookers, Ovens & Hobs > Cooking Appliance Parts
£77.30
Shipping: Free
eBay - shop4spares
Hotpoint HO455CBUK Built In Single Electric Oven - Black 7722501
Hotpoint HO455CBUK Built In Single Electric Oven - Black 7722501
This Hotpoint Built In Single Oven makes everyday cooking straightforward with a 71l capacity for family roasts, batch baking, or weeknight dinners. The multifunction design offers 5 cooking options including fan, grill and defrost, while Multiflow technology circulates heat evenly across 3 shelf levels to cook multiple dishes without flavour transfer. With 28 auto recipes, a programmable digital timer, and simple dial controls, you can set it and forget it. Catalytic liners catch grease and burn it off, and the Click & Clean removable door makes wiping down the easy-clean interior simpler. Inside you'll find 2 shelves, an interior light, and a full-width electric grill, all in a sleek black finish that fits standard 60cm apertures. The double-glazed door locks in heat, and the digital display shows cooking time clearly. It comes with a 3-pin plug for easy wall socket connection, no hardwiring needed, and fits under your worktop or at eye level. Measuring 59.5cm square and 55.1cm deep, it fits standard spaces with an A energy rating at 0.99kWh consumption. Backed by a 10-year parts guarantee and 1-year labour, it's built to last. Multiflow - Hotpoint's Multiflow technology ensures a precise and consistent temperature across every shelf, so every dish is cooked to perfection—no matter where it's placed. With the ability to cook on up to three levels simultaneously, you'll enjoy effortless efficiency. Overview:Digital clock. Programmable digital display timer. Digit display. Door window glazing: double glazed. Defrost function. Dial control. Front mounted controls. Main cavity:Multifunction oven cavity with 2 shelves. 71 litre capacity. Interior light. Main cavity door hinge position: bottom. Catalytic liners. Easy clean interior. Energy efficiency rating A. Energy consumption 0.99kWh. Grill:Electric (full width) grill. Combined with top oven. Dimensions:Oven size H59.5, W59.5, D55.1cm. Oven to fit aperture (space required H60, W56, D55.5cm). Fits in eye level worktop. General information:Oven comes with a 3-pin plug attached that goes into a socket in the wall. Manufacturer's 10 year parts and 1 year labour guarantee. EAN: 5054645705900.
3 to 5 day
£229.00
Shipping: £9.95
Hisense BI62220ABGUK Built In Single Electric Oven - Black 4464336
Hisense BI62220ABGUK Built In Single Electric Oven - Black 4464336
This Hisense Built In Single Oven handles everything from weeknight dinners to bigger family meals with a 61l cavity and 7 cooking functions that include fan, defrost and a full-width grill. The fan circulates hot air for even baking, so everything comes out cooked through without hot spots or burnt edges. The touch screen and ergonomic push-in dials make adjustments straightforward, and the LED display with programmable timer means you can set it and forget it. With 4 cooking levels, you can fit multiple dishes in at once - ideal when you're juggling sides and mains. The double-glazed door keeps heat in and the kitchen cooler, while the easy-clean enamel interior and removable inner glass door make post-dinner cleanup much simpler. It includes 1 shelf and an interior light so you can check on progress without opening the door. It fits neatly under your worktop or at eye level, needs hardwiring into a cooker point, and slots into standard 60cm spaces. At A-rated energy efficiency and 0.77kWh consumption, it's backed by a 2-year manufacturer's guarantee. 61L Capacity -With it's spacious 61L capacity, you can cook multiple dishes at once, ideal for family meals and entertaining. Equipped with four cooking levels, perfect for simultaneous cooking. Energy efficient and versatile, this oven enhances your cooking experience while handling large meals with ease. Overview:Digital clock. Digital display timer. LED display. Door window glazing: double glazed. Defrost function. Dial control. Front mounted controls. Main cavity:Fan oven cavity with 1 shelf. 61 litre capacity. Interior light. Main cavity door hinge position: bottom. Easy-clean enamel. Easy clean interior. Removable inner glass door for easy cleaning. Energy efficiency rating A. Energy consumption 0.77kWh. Grill:Electric (full width) grill. Combined with oven. Grill tray not included. Dimensions:Oven size H59.5, W59.5, D53cm. Oven to fit aperture (space required H60, W56, D58cm). Fits in eye level worktop. Fits under worktop. General information:Manufacturer's 2 year guarantee. EAN: 3838782863196.
3 to 5 day
£199.00
Shipping: £9.95
Hotpoint HO455CBUK Built In Single Electric Oven - Black 7722525
Hotpoint HO455CBUK Built In Single Electric Oven - Black 7722525
This Hotpoint Built In Single Oven gives you a generous 71l cavity with multifunction cooking, so you can handle everything from family roasts to batch baking across 3 levels without flavours mixing. The Multiflow technology circulates heat evenly throughout the oven, which means consistent results no matter which shelf you're using. With 5 cooking functions including defrost and a full-width grill, plus 28 auto recipes built in, it takes the guesswork out of everyday cooking and gives you plenty of options for whatever's on the menu. The catalytic liners use heat to break down grease while you cook, reducing scrubbing, and the Click & Clean removable door gives easy access for a thorough clean. The programmable digital timer and simple dial controls make it easy to set and adjust, while the double-glazed door keeps heat in and your kitchen cooler. It includes 2 shelves, interior light, and an easy-clean interior, fitting standard 60cm apertures at 59.5cm square. With an A energy rating at 0.99kWh consumption, it plugs into a standard socket and comes with a 10-year parts and 1-year labour guarantee. Multiflow - Hotpoint's Multiflow technology ensures a precise and consistent temperature across every shelf, so every dish is cooked to perfection—no matter where it's placed. With the ability to cook on up to three levels simultaneously, you'll enjoy effortless efficiency. Overview:Digital clock. Programmable digital display timer. Digit display. Door window glazing: double glazed. Defrost function. Dial control. Front mounted controls. Main cavity:Multifunction oven cavity with 2 shelves. 71 litre capacity. Interior light. Main cavity door hinge position: bottom. Catalytic liners. Easy clean interior. Energy efficiency rating A. Energy consumption 0.99kWh. Grill:Electric (full width) grill. Combined with top oven. Dimensions:Oven size H59.5, W59.5, D55.1cm. Oven to fit aperture (space required H60, W56, D55.5cm). Fits in eye level worktop. General information:Oven comes with a 3-pin plug attached that goes into a socket in the wall. Manufacturer's 10 year parts and 1 year labour guarantee. EAN: 5054645705900.
3 to 5 day
£374.00
Shipping: Free
Hisense BSA66346PDBGUK Built In Single Electric Oven -Black 3364688
Hisense BSA66346PDBGUK Built In Single Electric Oven -Black 3364688
This Hisense Built In Single Oven makes family cooking and batch baking effortless, with a 77l capacity and 5 shelf levels to roast, bake and grill simultaneously. Wi-Fi connectivity lets you preheat and monitor meals remotely via the Connect Life app. The multifunction fan offers Air Fry mode for guilt-free chips, Steam Add for perfect bakes, Pizza Mode, and 22 automatic programmes. The full-width electric grill handles everything from melting cheese to veggie skewers, and pyrolytic self-clean turns grease to ash with high heat, reducing scrubbing time. The sleek jet black touch control interface makes navigation easy, with quick-access buttons and a programmable LED timer for on-the-fly adjustments. The quadruple-glazed door locks in heat and keeps your kitchen cooler, while the interior light and removable glass door simplify checking and cleaning. It includes 5 shelves, a grill tray, child lock, and slow cook and defrost functions for flexibility. Fits standard 59.5cm apertures under your worktop or at eye level, requires hardwiring into a cooker point, and has an A energy rating at 1.03kWh. Backed by a 2-year manufacturer's guarantee. Experience steam cooking with Steam Add Plus for perfectly baked goods. Cook up a storm with an array of functions including Air Fry and Pizza Mode or make use of the 22 automatic programmes. Effortless maintenance with Pyrolytic Self-Clean which turns grease and grime to ash by using high heat. Overview:Digital clock. Programmable digital display timer. LED display. Door window glazing: quadruple glazed. Slow cook function. Defrost function. Touch control. Front mounted controls. Main cavity:Multifunction fan oven cavity with 5 shelves. 77 litre capacity. Interior light. Main cavity door hinge position: bottom. Pyrolytic cleaning. Easy clean interior. Energy efficiency rating A+. Energy consumption 1.03kWh. Grill:Electric (full width) grill. Combined with oven. Grill tray included (no handle). Dimensions:Oven size H59.5, W59.5, D66cm. Oven to fit aperture (space required H59.5, W59.5, D56.4cm). Fits in eye level worktop. Fits under worktop. General information:Oven needs to be hard wired into a cooker point on the wall and on its own circuit. Child lock. Wi-Fi. Manufacturer's 2 year guarantee. EAN: 3838782762130.
3 to 5 day
£549.00
Shipping: £9.95
Beko BBDM243BOC Built In Double Electric Oven - Black 4882798
Beko BBDM243BOC Built In Double Electric Oven - Black 4882798
Elevate your culinary experience with this 90cm Built-In Double Multi-Function Oven. Boasting a spacious fan oven, compact conventional oven, grill, and diverse cooking functions, it delivers versatile cooking options, helping you to create your favourite meals with ease. High Specification - Built-in Double Oven with fully featured Multifunction main oven. Touch Contol LED timer with push in push out knobs. Nano coating on the removable inner glass resists dirt and grime for ease of cleaning. Overview:Digital clock. Digital display timer. Digit display. Door window glazing: triple glazed. Defrost function. Touch control. Front mounted controls. Main cavity:Multifunction oven & grill cavity with 2 shelves. 71 litre capacity. Interior light. Main cavity door hinge position: bottom. Catalytic liners. Easy clean interior. Removable inner glass door for easy cleaning. Energy efficiency rating A. Energy consumption 0.95kWh. Second cavity:Conventional oven cavity with 1 shelf. 38 litre capacity. Interior light. Door hinge position: bottom. Catalytic liners. Easy clean interior. Energy efficiency rating A. Energy consumption 0.68kWh. Grill:Electric (full width) grill. Grill tray included (no handle). Hob:Griddle plate. Dimensions:Oven size H89, W59.4, D56.7cm. Oven to fit aperture (space required H88, W56, D55cm). General information:Oven needs to be hard wired into a cooker point on the wall and on its own circuit. Manufacturer's 2 years on registration guarantee. EAN: 8690842387760.
3 to 5 day
£539.00
Shipping: £9.95
Hotpoint HO475PBUK Built In Single Electric Oven - Black 7722707
Hotpoint HO475PBUK Built In Single Electric Oven - Black 7722707
This Hotpoint Built In Single Electric Oven is a multifunction workhorse that makes family cooking straightforward. With a 71l cavity and 5 cooking functions, including fan, slow cook, defrost and a full-width Turbo Grill for crisp finishes, it handles midweek roasts and batch baking across 3 levels. Multiflow technology circulates heat evenly for consistent results on every shelf. The programmable digital timer and clear display make setting cooking time easy, while the double-glazed door keeps heat in and your kitchen cooler. Inside, the pyrolytic cleaning function heats to burn off food residue, leaving ash to wipe away, meaning less scrubbing. The removable Click & Clean door gives quick access to every corner without tools, and the easy-clean interior keeps maintenance simple. It includes 2 shelves, an interior light, and 28 auto recipes. At 59.5cm square, it fits standard apertures and can be installed at eye level or under your worktop. It comes with a 3-pin plug, requires a socket rather than hardwiring, and has an A energy rating at 0.52kWh consumption. Backed by a 10-year parts and 1-year labour guarantee. Multiflow - Hotpoint's Multiflow technology ensures a precise and consistent temperature across every shelf, so every dish is cooked to perfection—no matter where it's placed. With the ability to cook on up to three levels simultaneously, you'll enjoy effortless efficiency. Overview:Digital clock. Programmable digital display timer. Digit display. Door window glazing: double glazed. Slow cook function. Defrost function. Dial control. Front mounted controls. Main cavity:Multifunction oven cavity with 2 shelves. 71 litre capacity. Interior light. Main cavity door hinge position: bottom. Pyrolytic cleaning. Easy clean interior. Energy efficiency rating A++. Energy consumption 0.52kWh. Grill:Electric (full width) grill. Combined with top oven. Dimensions:Oven size H59.5, W59.5, D55.1cm. Oven to fit aperture (space required H60, W56, D55.5cm). Fits in eye level worktop. General information:Oven comes with a 3-pin plug attached that goes into a socket in the wall. Manufacturer's 10 year parts and 1 year labour guarantee. EAN: 5054645704590.
3 to 5 day
£299.00
Shipping: £9.95
Indesit IO233BUK Built In Single Electric Oven - Black 7653285
Indesit IO233BUK Built In Single Electric Oven - Black 7653285
This Indesit Built In Single Oven is the kind of everyday cooking companion that handles everything from weeknight dinners to full family roasts without any fuss. With a 66l fan oven cavity, it circulates heat evenly so your food cooks through properly - no burnt edges or undercooked centres. The Grill Plus Fan feature combines the intense heat of the full-width grill with the fan to cook meals faster and more evenly, perfect for getting that crispy, golden finish on meats and vegetables while keeping everything tender inside. The Click&Clean system lets you press tabs on the door and pull out the inner glass in 2 steps, making cleaning easy. The tilting grill unhooks and pulls down in one move, allowing you to wipe away grease from awkward spots. With button controls, an analogue clock, and a double-glazed door, it fits standard 60cm apertures at eye level or under your worktop. It includes 3 shelves, an interior light, easy-clean enamel interior, and steam cleaning. A-rated at 0.79kWh, it plugs into a standard socket and has a 10-year parts and 1-year labour guarantee. Click&Clean - Keep your oven door sparkling with the effortless Click&Clean 2-step system. Just press the tabs on the side of the door and pull out the inner glass to wash. Cleaning has never been easier. Overview:Analogue clock. Door window glazing: double glazed. Button control. Front mounted controls. Main cavity:Fan oven cavity with 3 shelves. 66 litre capacity. Interior light. Steam cleaning. Easy clean interior. Removable inner glass door for easy cleaning. Energy efficiency rating A. Energy consumption 0.79kWh. Grill:Electric (full width) grill. Combined with oven. Dimensions:Oven size H59.5, W59.5, D55.1cm. Oven to fit aperture (space required H60, W56, D55.5cm). Fits in eye level worktop. General information:Oven comes with a 3-pin plug attached that goes into a socket in the wall. Manufacturer's 10 year parts and 1 year labour guarantee. EAN: 8050147705070.
3 to 5 day
£334.00
Shipping: Free
Hisense BI62020ABGUK Built In Single Electric Oven - Black 4464329
Hisense BI62020ABGUK Built In Single Electric Oven - Black 4464329
This Hisense Built In Single Oven is a straightforward kitchen workhorse for family dinners and weekend baking. With a roomy 60l capacity and 7 functions, including fan, grill, defrost and interior light, it offers space and versatility for everyday cooking. The Even Bake system circulates hot air for crispy outsides and moist insides, while easy-clean enamel liners reduce grease build-up. Push-in dials sit flush for precise control and easy wiping, and the double-glazed door keeps heat inside. Inside, you get 1 shelf, an interior light, and removable inner glass door for straightforward cleaning when you need it. The full-width electric grill is combined with the oven for versatile cooking options, though a grill tray isn't included. It's designed to fit under your worktop or at eye level, needs hardwiring into a cooker point, and fits standard 60cm spaces at H59.5, W59.5, D53cm. With an A energy rating and 0.77kWh consumption, plus a 2-year manufacturer's guarantee, it's built to handle daily use without running up the bills. 60L Capacity - With it's spacious 60L capacity, you can cook multiple dishes at once, ideal for family meals and entertaining. Equipped with four cooking levels, perfect for simultaneous cooking. Energy efficient and versatile, this oven enhances your cooking experience while handling large meals with ease. Overview:No digital display. Door window glazing: double glazed. Defrost function. Dial control. Front mounted controls. Main cavity:Fan oven cavity with 1 shelf. 60 litre capacity. Interior light. Main cavity door hinge position: bottom. Easy-clean enamel. Easy clean interior. Removable inner glass door for easy cleaning. Energy efficiency rating A. Energy consumption 0.77kWh. Grill:Electric (full width) grill. Combined with oven. Grill tray not included. Dimensions:Oven size H59.5, W59.5, D53cm. Oven to fit aperture (space required H60, W56, D58cm). Fits in eye level worktop. Fits under worktop. General information:Manufacturer's 2 year guarantee. EAN: 3838782863189.
3 to 5 day
£324.00
Shipping: Free
Russell Hobbs RHFEO7004SS Built In Single Electric Oven 7262542
Russell Hobbs RHFEO7004SS Built In Single Electric Oven 7262542
This Russell Hobbs Built-In Electric Fan Oven has a sleek design that will complement any kitchen. The single cavity with an impressive 70L capacity and 5 oven functions make this oven perfect for all your family's cooking needs. The handy eco mode saves energy as the fan distributes the heated air around the food from the top and rear heating elements. The easy clean interior will keep your oven looking newer for longer. Prepare meals for your entire family with ease, thanks to the generous 70L capacity of this oven, offering maximum oven space. Whether you're baking, roasting, or grilling, this trusty kitchen companion ensures that heat gets evenly distributed, leaving you with perfectly cooked meals every time. Take your pick from convection, eco, fan grill, grill, and defrost settings as well as an energy-saving eco mode. Overview:Door window glazing: double glazed. Defrost function. Dial control. Front mounted controls. Main cavity:Fan oven cavity with 2 shelves. 70 litre capacity. Interior light. Main cavity door hinge position: bottom. Easy-clean enamel. Easy clean interior. Energy efficiency rating A. Energy consumption 0.75kWh. Grill:Electric (full width) grill. Combined with oven. Grill tray included (no handle). Dimensions:Oven size H59.5, W59.5, D57.5cm. Oven to fit aperture (space required H60, W56, D57cm). Fits in eye level worktop. Fits under worktop. General information:Oven needs to be hard wired into a cooker point on the wall and on its own circuit. Manufacturer's 2 year guarantee. EAN: 5056233831732.
3 to 5 day
£159.00
Shipping: £9.95
SMEG Cucina SF6400TB Electric Oven - Black, Black 10262457
SMEG Cucina SF6400TB Electric Oven - Black, Black 10262457
Get perfect results every time with this Smeg electric oven. Its Circulaire function keeps the air clean as you're cooking, helping to avoid any mixing of flavours and odour. That means you won't have worry about your pizza tasting like a grilled fish. Plus, it's a multifunction oven, which means it's got loads of programs to choose from. And the powerful fan heat will distribute hot air all around the oven, so everything cooks faster and more evenly. Good to know - Its large 70 litre capacity is big enough for family dinners or get-togethers - Spend less time scrubbing away dirt thanks to the Vapor clean function - The enamel coating on the inside of the oven can easily be wiped off using a damp cloth - The removable glass viewing door makes it simple to do all of your cleaning without having to hunch over_________________________________________PLEASE NOTE:ELECTRICAL INSTALLATION: This product requires professional installation to a 13 Amp fused spur by a qualified installer, such as one of our Tech Experts.
"1 to 3 days"
£349.00
Shipping: £45.00
Hotpoint DIH82GB Built In Double Electric Oven - Black 7722116
Hotpoint DIH82GB Built In Double Electric Oven - Black 7722116
The Hotpoint Built-In double oven offers flexibility with a 71L main oven and 38L top oven—ideal for quick meals or large feasts. Its black design, 8 cooking functions, and digital display make cooking effortless. The Twin Grill lets you use full or half power to save energy. A programmable timer ensures perfect results, while self-cleaning catalytic panels burn off grease for easy cleaning—perfect for busy family homes. Catalytic Liners in Both Cavities - Catalytic liners are special panels that catch fat spits and grease, removing them naturally during the cooking process, so when your passion is cooking, not cleaning, Hotpoint has you covered. Digital Display - The digital display gives you feedback at a glance, so you can set the timer, and your oven will alert you when your meal is ready. Programmable Timer - When you're juggling a busy household, our handy programmable timer has your back. It alerts you when your meal is ready, so you won't have to worry about overcooking dinner. Overview:Digital clock. Programmable digital display timer. LED display. Door window glazing: double glazed. Slow cook function. Defrost function. Dial control. Front mounted controls. Main cavity:Multifunction oven cavity with 2 shelves. 71 litre capacity. Interior light. Main cavity door hinge position: bottom. Catalytic liners. Easy clean interior. Energy efficiency rating A. Energy consumption 0.95kWh. Second cavity:Multifunction oven & grill cavity with 1 shelf. 38 litre capacity. Interior light. Door hinge position: bottom. Catalytic liners. Easy clean interior. Energy efficiency rating A. Energy consumption 0.68kWh. Grill:Electric (full width) grill. Combined with top oven. Dimensions:Oven size H89, W59.4, D56.7cm. Oven to fit aperture (space required H87.5, W56, D55cm). Fits in eye level worktop. General information:Oven needs to be hard wired into a cooker point on the wall and on its own circuit. Manufacturer's 10 year parts and 1 year labour guarantee. EAN: 5054645712595.
3 to 5 day
£429.00
Shipping: £9.95
Mini Hob Electric Oven Single Burner 500W Heating Plate
Mini Hob Electric Oven Single Burner 500W Heating Plate
1. APPLICATION: This electric stove is suitable for home, hotel, office, camping and caravan. It can heat stainless steel mocha pots, coffee pots,
£100.32
Shipping: Free
Bush BIBCP Built-In Single Electric Oven & Ceramic Hob Pack 4639903
Bush BIBCP Built-In Single Electric Oven & Ceramic Hob Pack 4639903
The Bush BIBCP Built-In Single Electric Oven & Ceramic Hob Pack makes everyday cooking easier with flexible features. The multifunction oven offers 7 cooking functions including defrost, so you can roast chicken, bake biscuits, or warm frozen food without fuss. The full-width electric grill inside the oven includes a tray and handle for toasting, grilling bacon, or finishing gratins. The ceramic hob has 4 zones (2 small, 2 large) with 9 power levels, providing precise heat from a gentle simmer to a rapid boil. Touch controls on the hob and front-mounted oven controls keep everything within easy reach, while the triple-glazed oven door stays cooler on the outside. Inside, the easy-clean enamel lining wipes down quickly, and the removable inner glass door makes it simple to reach every corner. One oven shelf and an interior light help you keep an eye on progress. Suitable for built-in installation with hardwiring into a dedicated circuit, this cooker has an A energy rating and comes with a 1 year manufacturer's guarantee. Overview:Single oven. Front mounted controls with touch controlhob. Defrost function. Oven door window glazing: triple glazed. Main cavity:Multifunction oven with 1 shelf. 56 litre usable capacity. Interior light. Easy-clean enamel. Easy clean interior. Removable inner glass door for easy cleaning. Main cavity hinge position: bottom. Main cavity energy efficiency rating A. Hob:Number of hobs: 4. Ceramic. 4 gas burners. Grill:Electric (full width) grill. Combined with oven. Grill tray and handle included. General information:Size H59.4, W59.4, D49.8cm. Weight 34.7kg. Manufacturer's 1 year guarantee.
3 to 5 day
£425.00
Shipping: Free
Russell Hobbs RHEO7005SS Built In Single Electric Oven 7653034
Russell Hobbs RHEO7005SS Built In Single Electric Oven 7653034
This Russell Hobbs Built In Single Oven handles the full spectrum of family cooking, from weeknight roasts to weekend batch baking. With a 70l cavity and 10 functions, including fan, convection, full-width grill, defrost and an eco mode to reduce energy use, it offers flexible cooking without compromise. The fan circulates heat evenly, ensuring no hot spots or undercooked patches. The LED display and dial controls make setting temperature and time straightforward, while the double-glazed door keeps heat inside where it belongs. Inside, you'll find an easy-clean enamel finish that cuts down on scrubbing, an interior light so you can check progress without opening the door, and 2 shelves plus a grill tray to get you started. It fits neatly into standard 56cm apertures and can be installed under your worktop or at eye level depending on your kitchen layout. Hardwiring into a cooker point is required, and it comes with a 2-year manufacturer's guarantee. At 59.5cm square and with an A energy rating at 0.95kWh consumption, it's designed to slot into your kitchen and your routine without fuss. Prepare meals for your entire family with ease, thanks to the generous 70L capacity of this oven, offering maximum oven space. Overview:Digital clock. Digital display timer. LED display. FSD compliant - stops gas flow once the flame is extinguished. Door window glazing: double glazed. Defrost function. Dial control. Front mounted controls. Main cavity:Multifunction oven & grill cavity with 2 shelves. 70 litre capacity. Interior light. Main cavity door hinge position: bottom. Easy-clean enamel. Easy clean interior. Energy efficiency rating A. Energy consumption 0.95kWh. Grill:Electric (full width) grill. Combined with oven. Grill tray included (no handle). Dimensions:Oven size H59.5, W59.5, D57.5cm. Oven to fit aperture (space required H60, W56, D57cm). Fits in eye level worktop. Fits under worktop. General information:Oven needs to be hard wired into a cooker point on the wall and on its own circuit. Manufacturer's 2 year guarantee. EAN: 5056233831756.
3 to 5 day
£184.00
Shipping: £9.95
Russell Hobbs RHEO7005SS Built In Single Electric Oven 7837843
Russell Hobbs RHEO7005SS Built In Single Electric Oven 7837843
This Russell Hobbs Built In Single Oven quietly handles everyday family cooking. With a 70l cavity and 10 functions, including convection, fan grill, full-width grill, defrost and an eco mode for lower energy use, it covers weeknight dinners to weekend roasting and batch baking. The fan spreads heat evenly for consistent results with roasts or loaded trays. The LED display and simple dial controls make setting temperature and time easy and fuss-free. With double-glazed door to keep the heat in, easy-clean enamel interior, and an interior light so you can check progress without opening the door, it's built for practicality. It comes with 2 shelves and a grill tray, fits neatly under your worktop or at eye level depending on your kitchen setup, and needs hardwiring into a cooker point. At 59.5cm square, it slots into standard 56cm apertures with an A energy rating and 0.95kWh consumption, backed by a 2-year manufacturer's guarantee. Prepare meals for your entire family with ease, thanks to the generous 70L capacity of this oven, offering maximum oven space. Overview:Digital clock. Digital display timer. LED display. FSD compliant - stops gas flow once the flame is extinguished. Door window glazing: double glazed. Defrost function. Dial control. Front mounted controls. Main cavity:Multifunction oven & grill cavity with 2 shelves. 70 litre capacity. Interior light. Main cavity door hinge position: bottom. Easy-clean enamel. Easy clean interior. Energy efficiency rating A. Energy consumption 0.95kWh. Grill:Electric (full width) grill. Combined with oven. Grill tray included (no handle). Dimensions:Oven size H59.5, W59.5, D57.5cm. Oven to fit aperture (space required H60, W56, D57cm). Fits in eye level worktop. Fits under worktop. General information:Oven needs to be hard wired into a cooker point on the wall and on its own circuit. Manufacturer's 2 year guarantee. EAN: 5056233831756.
3 to 5 day
£329.00
Shipping: Free
Hisense HO66FAPizzaChef Built In Single Electric Oven -Black 4191056
Hisense HO66FAPizzaChef Built In Single Electric Oven -Black 4191056
This Hisense Built In Single Electric Oven is made for serious home cooking, featuring Pizza Mode Pro that heats to 350C and cooks pizzas in 3m 30s with the included tray and peel. Its 77l capacity offers 5 cooking levels, letting you roast, bake, air fry, and grill simultaneously. It includes slow cook and defrost modes, plus pyrolytic self-cleaning that turns grime to ash for easy cleanup. The jet-black glass front with touch controls looks modern, and the quadruple-glazed door locks in heat while keeping your kitchen cool. Inside, you get an interior light, easy-clean surfaces, and a full-width electric grill combined with the oven. The LED display and programmable timer with delayed start simplify meal planning, and built-in Wi-Fi lets you monitor cooking remotely. It comes with a grill tray, fits standard 56cm apertures, and can be installed at eye level or under your worktop. Hardwiring into a cooker point is required. With an A energy rating, 1.03kWh consumption, child lock for safety, and a 2-year manufacturer's guarantee, it handles everything from weeknight dinners to pizza parties without missing a beat. Pizza Mode Pro - Pizza Mode Pro heats to 350 degree celsius, reducing baking time by 40%. Enjoy perfect pizzas in 3m 30s with included tray and peel. Transform your kitchen into a pizza paradise-no extra appliances needed. Overview:Digital clock. Programmable digital display timer. LED display. Door window glazing: quadruple glazed. Slow cook function. Defrost function. Touch control. Front mounted controls. Delayed start. Main cavity:Multifunction oven cavity with 5 shelves. 77 litre capacity. Interior light. Main cavity door hinge position: bottom. Pyrolytic cleaning. Easy clean interior. Energy efficiency rating A+. Energy consumption 1.03kWh. Grill:Electric (full width) grill. Combined with oven. Grill tray included (no handle). Dimensions:Oven size H66, W62, D67.5cm. Oven to fit aperture (space required H39, W47.3, D41.9cm). Fits in eye level worktop. Fits under worktop. General information:Oven needs to be hard wired into a cooker point on the wall and on its own circuit. Child lock. Wi-Fi. Manufacturer's 2 year guarantee. EAN: 3838782900846.
3 to 5 day
£549.00
Shipping: £9.95
Hisense BSA66346ADBGUK Built In Single Electric Oven -Black 3364482
Hisense BSA66346ADBGUK Built In Single Electric Oven -Black 3364482
This Hisense Built In Single Oven is a proper multitasker with a generous 77l capacity and Wi-Fi control via the Connect Life app, so you can preheat on your way home or check on things remotely. The multifunction fan cavity offers 5 shelf levels and 22 automatic programmes, plus clever modes like Air Fry and Pizza to handle everything from crispy chips to family roasts without needing extra appliances. Steam Add gives you bakery-level results, and Steam Clean makes tackling grease a lot less hassle - no harsh chemicals needed. The full touch control interface is sleek and straightforward to navigate, with a programmable LED timer display and quick-access function buttons. Inside you'll find catalytic liners, an interior light, and a triple-glazed door to keep heat in and your kitchen cooler. It comes with 5 shelves, a grill tray, slow cook and defrost functions, plus a child lock for peace of mind. Fitting into standard 59.5cm apertures under worktop or at eye level, it needs hardwiring into a cooker point, has an A energy rating at 0.97kWh, and comes with a 2-year guarantee. Experience steam cooking with Steam Add Plus for perfectly baked goods. Cook up a storm with an array of functions including Air Fry and Pizza Mode or make use of the 22 automatic programmes. Effortless maintenance with Steam Clean, which helps to banish grease and grime without using harsh chemicals. Overview:Digital clock. Programmable digital display timer. LED display. Door window glazing: triple glazed. Slow cook function. Defrost function. Touch control. Front mounted controls. Main cavity:Multifunction fan oven cavity with 5 shelves. 77 litre capacity. Interior light. Main cavity door hinge position: bottom. Catalytic liners. Easy clean interior. Energy efficiency rating A+. Energy consumption 0.97kWh. Second cavity:Catalytic liners. Grill:Electric (full width) grill. Combined with oven. Grill tray included (no handle). Dimensions:Oven size H59.5, W59.5, D56.4cm. Oven to fit aperture (space required H59.5, W59.5, D56.4cm). Fits in eye level worktop. Fits under worktop. General information:Oven needs to be hard wired into a cooker point on the wall and on its own circuit. Child lock. Wi-Fi. Manufacturer's 2 year guarantee. EAN: 3838782762147.
3 to 5 day
£644.00
Shipping: Free
Bush BIBCP Built-In Single Electric Oven & Ceramic Hob Pack 4639594
Bush BIBCP Built-In Single Electric Oven & Ceramic Hob Pack 4639594
The Bush BIBCP Built-In Single Electric Oven & Ceramic Hob Pack makes everyday cooking straightforward with features designed for real-life kitchens. The multifunction oven gives you 7 cooking functions plus a full-width electric grill, so you can roast a chicken, bake a batch of cookies, or defrost ingredients with ease. The ceramic hob has 4 zones - 2 small and 2 large - with 9 power levels and touch controls, giving you flexibility whether you're simmering a sauce or boiling pasta fast. The easy-clean enamel interior wipes down quickly after cooking, and the removable inner glass door makes thorough cleaning simple. Triple-glazed oven door keeps heat inside while staying cooler on the outside, and the interior light lets you check on progress without opening the door. Front-mounted controls are easy to reach, and the cooker includes 1 oven shelf plus a grill tray and handle. It's designed to fit standard built-in spaces and comes with a 1 year manufacturer's guarantee. Overview:Single oven. Front mounted controls with touch controlhob. Defrost function. Oven door window glazing: triple glazed. Main cavity:Multifunction oven with 1 shelf. 56 litre usable capacity. Interior light. Easy-clean enamel. Easy clean interior. Removable inner glass door for easy cleaning. Main cavity hinge position: bottom. Main cavity energy efficiency rating A. Hob:Number of hobs: 4. Ceramic. 4 gas burners. Grill:Electric (full width) grill. Combined with oven. Grill tray and handle included. General information:Size H59.4, W59.4, D49.8cm. Weight 34.7kg. Manufacturer's 1 year guarantee.
3 to 5 day
£280.00
Shipping: £9.95
Hisense BI64221PDBG Built In Single Electric Oven - Black 7535152
Hisense BI64221PDBG Built In Single Electric Oven - Black 7535152
This Hisense BI64221PDBG Built In Single Oven is a multifunction workhorse that handles family roasts, batch baking, and more with ease. With a 77l capacity and 5 shelf positions, you can cook multiple dishes at once, perfect for Sunday dinners or meal-prepping. The air fry mode crisps chips and wings without extra gadgets or oil, while pizza, slow cook, and defrost settings add flexibility. The pyrolytic self-cleaning heats to high temperatures, turning residue to ash for easy wiping without scrubbing. The touch controls and LED display make setting times and temperatures straightforward, and the quadruple-glazed door keeps heat locked in while staying cooler on the outside. Inside, there's an interior light, easy-clean enamel, and removable inner glass so maintenance stays simple. It comes with a full-width electric grill and grill tray, fits standard 59.5cm apertures under your worktop or at eye level, and needs hardwiring into a cooker point. With an A energy rating at 1.03kWh consumption, a child lock, and a 2-year manufacturer's guarantee, it's built for everyday family cooking. 77L Capacity - Transform your kitchen with the Hisense 77L capacity oven, perfect for family meals and entertaining guests. This spacious oven features 5 cooking levels, allowing you to simultaneously cook meals, ideal for hosting guests or if you're an avid batch cooker. Overview:Digital clock. Programmable digital display timer. LED display. Door window glazing: quadruple glazed. Slow cook function. Defrost function. Touch control. Front mounted controls. Delayed start. Main cavity:Multifunction oven cavity with 5 shelves. 77 litre capacity. Interior light. Main cavity door hinge position: bottom. Pyrolytic cleaning. Easy clean interior. Removable inner glass door for easy cleaning. Energy efficiency rating A+. Energy consumption 1.03kWh. Grill:Electric (full width) grill. Combined with oven. Grill tray included (no handle). Dimensions:Oven size H59.5, W59.5, D56.4cm. Fits in eye level worktop. Fits under worktop. General information:Oven needs to be hard wired into a cooker point on the wall and on its own circuit. Child lock. Manufacturer's 2 year guarantee. EAN: 3838782861383.
3 to 5 day
£349.00
Shipping: £9.95
Hotpoint DIH10DW Built In Double Electric Oven - White 7745100
Hotpoint DIH10DW Built In Double Electric Oven - White 7745100
This Hotpoint Built In Double Oven offers true two-oven cooking so you can roast and bake at different temperatures without waiting. The main cavity provides 75l of fan oven space with 3 shelves, while the 38l top oven works as a conventional oven or full-width grill, ideal for big meals or quick warming. The LED display and programmable timer let you set it and forget it, with an alert when food's ready. Both cavities have easy-clean enamel liners, double-glazed doors to retain heat, and interior lights to check progress without opening the door. The dial controls keep things simple, and you get useful extras like slow cook and defrost functions for flexibility. It needs hardwiring into a cooker point and fits standard apertures at H87.5, W56, D55cm, with eye-level or under-worktop installation options. The main oven is A-rated at 0.82kWh and the top oven at 0.68kWh, so running costs stay sensible. It comes with a grill tray and handle, and there's a 10-year parts and 1-year labour guarantee. At 89cm tall and finished in white, it's built to handle everyday family cooking without fuss. Enamel Liners in Both Cavities - Hotpoint has your oven cleaning covered with easy to wipe clean enamel liners, so you spend less time cleaning the oven. Overview:Digital clock. Programmable digital display timer. LED display. Door window glazing: double glazed. Slow cook function. Defrost function. Dial control. Front mounted controls. Main cavity:Fan oven cavity with 3 shelves. 75 litre capacity. Interior light. Main cavity door hinge position: bottom. Easy-clean enamel. Easy clean interior. Energy efficiency rating A. Energy consumption 0.82kWh. Second cavity:Conventional oven cavity with 1 shelf. 38 litre capacity. Interior light. Door hinge position: bottom. Easy-clean enamel. Easy clean interior. Energy efficiency rating A. Energy consumption 0.68kWh. Grill:Electric (full width) grill. Combined with top oven. Grill tray and handle included. Dimensions:Oven size H89, W59.4, D56.7cm. Oven to fit aperture (space required H87.5, W56, D55cm). Fits in eye level worktop. General information:Oven needs to be hard wired into a cooker point on the wall and on its own circuit. Manufacturer's 10 year parts and 1 year labour guarantee. EAN: 5054645712519.
3 to 5 day
£359.00
Shipping: £9.95
Kaiser Art Deco Multi 9 Electric Oven EH 6427 AD
Kaiser Art Deco Multi 9 Electric Oven EH 6427 AD
The Art Deco EH 6427 AD - A stunningly beautiful, single electric oven that will elevate the look of any kitchen. This is our Antique Gold colour...
£1,097.10
Shipping: Free
MyApplianceSpares Timer Assembly Clock for Beko Electric Oven BXIF243X
MyApplianceSpares Timer Assembly Clock for Beko Electric Oven BXIF243X
Product details:  Timer Assembly Clock made for MyApplianceSpares to fit Beko Electric Oven models. Manufacture part number:  ...
£129.90
Shipping: Free
Kaiser Empire Single Electric Oven - Black Silver EH 6355 SilEm
Kaiser Empire Single Electric Oven - Black Silver EH 6355 SilEm
The Empire EH 6355 SilEm is a 63-litre electric oven, finished in an enamelled black silver for a vintage look and style. Designed to make cooking...
£728.10
Shipping: Free
Totority 5Pcs Chicken Roast Tong For Electric Oven And Air Fryer
Totority 5Pcs Chicken Roast Tong For Electric Oven And Air Fryer
Description This electronic oven tong is designed for safely handling food in your oven or air fryer. The anti-scald food fork you can easily take...
£55.75
Shipping: Free
Steam conduit for Electric oven ES25A ABP-TZ25A ZJXPABAJA
Steam conduit for Electric oven ES25A ABP-TZ25A ZJXPABAJA
100% brand new and high quality. Made of high quality material, durable and practical to use. Delicate and exquisite, highly match the equipment. Solid and durable, long service life. Easy to install and reliable to use., Manufacturer: WYHONYG
£62.30
Shipping: Free
Amazon Marketplace - bingyuwangluo
Bosch Original Stainless Steel Electric Oven Water Tank 231376_4242005256877
Bosch Original Stainless Steel Electric Oven Water Tank 231376_4242005256877
Tank: Tank for Gaggenau, Siemens, Bosch, Neff Oven Compatible with BS225100/03, BS225100/04, BS225100/07, BS225100/09, BS225100/10, BS225100/11, Bs225100/11, Bs225100/11 S22511 10/02, BS225110/03, BS225110/04, BS225110/06, BS225110/07, BS225110/09, BS225110/10, BS225110/11, BS225110/11, BS2255110/11 130 cm 2, BS225130/03, BS225130/04, BS225130/07, BS225130/09, BS225130/10, BS225130/11, BS251100/05, BS251100/05, BS251100/05, BS251100/05 06 Reservoirs
£80.55
Shipping: Free
Amazon Marketplace - SOS-Accessoire
AEG SurroundCook BEX335011B Electric Oven - Black, Black 10261433
AEG SurroundCook BEX335011B Electric Oven - Black, Black 10261433
Take your baking from bland to grand with this AEG oven. The SurroundCook convection system blows hot air around the whole oven, so every meal is cooked evenly. Thanks to its fan technology, you'll get a perfect golden brown finish on your pies and roasts - every part of your dish gets the heat it needs. You can also bake large batches of sweet treats with its XL baking tray that is 20% larger than the usual ones. And finally, when you're done, Aqua Clean makes it effortless to wipe away those greasy residues using steam - no elbow grease required. Good to know - The Hot Air convection is so efficient that the oven heats up really quickly, saving you time and energy - The LED display with touch control gives you quick access to all the cooking functions - Cook the perfect cheese on toast or crispy bacon in the full width grillLoved by Currys ""Your dishes won't be spoiled by burnt edges or raw middles in this oven. Its SurroundCook convection system makes sure that hot air spreads evenly throughout the oven cavity. So, your food will be cooked perfectly."" - Chris, Product Copywriter _________________________________________ PLEASE NOTE:  ELECTRICAL INSTALLATION: This product requires professional installation to a 13 Amp fused spur by a qualified installer, such as one of our Tech Experts.
"1 to 3 days"
£329.00
Shipping: £45.00
AEG BEX335011B Built In Single Electric Oven - Black 2154291
AEG BEX335011B Built In Single Electric Oven - Black 2154291
This AEG Built In Single Oven handles weeknight roasts to weekend baking with a 72l capacity, perfect for family meals and batch cooking. The multifunction design covers fan-assisted cooking, full-width grilling, and more, so you're set for lasagne or trays of cookies. The XL baking tray is 20% larger than standard, offering more space for biscuits, brownies or any bake, cooked evenly thanks to consistent heat distribution. The clear LED timer lets you set alarms, check remaining time, and adjust with precision. With dial controls, a double-glazed door, and easy-clean enamel interior, it fits into your kitchen setup and routine without complication. It needs hardwiring into a cooker point, fits standard 60cm apertures at H60, W56, D55cm and comes with 3 shelves, a grill tray and handle, plus an interior light. At A-rated energy efficiency and 0.93kWh consumption, it's backed by a 2-year manufacturer's guarantee. Get evenly cooked food anywhere in the oven. Overview:Digital clock. Minute minder timer. LED display. Door window glazing: double glazed. Dial control. Front mounted controls. Main cavity:Multifunction oven & grill cavity with 3 shelves. 72 litre capacity. Interior light. Main cavity door hinge position: bottom. Easy-clean enamel. Easy clean interior. Energy efficiency rating A. Energy consumption 0.93kWh. Grill:Electric (full width) grill. Combined with oven. Grill tray and handle included. Dimensions:Oven size H59.4, W59.4, D56.9cm. Oven to fit aperture (space required H60, W56, D55cm). General information:Oven needs to be hard wired into a cooker point on the wall and on its own circuit. Manufacturer's 2 year parts and labour guarantee. EAN: 7333394054360.
3 to 5 day
£329.00
Shipping: £9.95
Traenvir Built-in Electric Oven, 60cm Wide,Single Oven with 65L Capaci
Traenvir Built-in Electric Oven, 60cm Wide,Single Oven with 65L Capaci
Traenvir Built-in Electric Oven, 60cm Wide,Single Oven with 65L Capacity, 4 Functions, Knob Control, Baking Tray Accessories, 220V, 2200W, Black...
£290.81
Shipping: £2.99
HOMCOM Mini Oven 15 Litres Electric Oven with 60 Minute Timer - Cream 8939236
HOMCOM Mini Oven 15 Litres Electric Oven with 60 Minute Timer - Cream 8939236
Retro styling for the everyday this HOMCOM countertop oven is a piece to love using and having in your home. The cream white colour, chrome accents and slight boxy shape gives it an old-school look with a modern twist. Adjust the temperature between 60-230easily, with a timer to help prevent food overcooking. It comes with two inner layers a shelf and pan, can be set to four different positions. Inner capacity 15 litres.
£42.99
Shipping: Free
The Range
Kaiser Belle Epoque Electric Oven | Black Multi 10 Pizza Stone Oven EH 6432 BE
Kaiser Belle Epoque Electric Oven | Black Multi 10 Pizza Stone Oven EH 6432 BE
The Belle Epoque Electric Oven - A stunningly beautiful, classicly styled oven that would be perfectly suited to a vintage style of kitchen. This...
£827.10
Shipping: Free
Samsung Dual Cook Flex Electric Oven with Added Steam - Stainless Steel
Samsung Dual Cook Flex Electric Oven with Added Steam - Stainless Steel
SmartThings — Connect to your oven from your phone Dual Cook Flex — Cook 2 separate dishes at once Air Sous Vide — Special cooking setting for tender food Dual Cook — Cook 2 separate dishes at once
£619.00
Shipping: £14.95
Energy Rating: A+
Amazon Marketplace - AO
Indesit IO253BUK Built In Single Electric Oven - Black 7653429
Indesit IO253BUK Built In Single Electric Oven - Black 7653429
This Indesit Built In Single Oven is designed for family cooking without the fuss, with a 66l fan oven cavity that handles roasts, bakes and everything in between. The Turn&Go function makes weeknight dinners effortless - no preheating needed, just pop your food in, turn the dial, and it automatically heats to 180C for an hour. The full-width electric grill is combined with the oven for versatile cooking, and the fan ensures heat circulates evenly so your food cooks consistently throughout. With dial controls, a digital timer, and double-glazed door, it's easy to use and keeps heat inside. The Click&Clean system removes the inner glass door in 2 steps for easy washing, while the tilting grill unhooks and pulls down to wipe away grease without stretching. The easy-clean enamel interior, removable glass door, and interior light simplify maintenance. It includes 2 shelves, fits standard 60cm apertures, and plugs into a standard 3-pin socket. At A-rated energy efficiency and 0.79kWh consumption, it's backed by a 10-year parts and 1-year labour guarantee. Turn&Go - An automatic cooking programme that simplifies everyday life. There's no need to preheat. Just pop your food in the oven, turn the dial, and it will heat to 180C, turning off after one hour. Overview:Digital clock. Digital display timer. Digit display. Door window glazing: double glazed. Dial control. Front mounted controls. Main cavity:Fan oven cavity with 2 shelves. 66 litre capacity. Interior light. Easy-clean enamel. Easy clean interior. Removable inner glass door for easy cleaning. Energy efficiency rating A. Energy consumption 0.79kWh. Grill:Electric (full width) grill. Combined with oven. Dimensions:Oven size H59.5, W59.5, D55.1cm. Oven to fit aperture (space required H60, W56, D55.5cm). Fits in eye level worktop. General information:Oven comes with a 3-pin plug attached that goes into a socket in the wall. Manufacturer's 10 year parts and 1 year labour guarantee. EAN: 8050147705186.
3 to 5 day
£344.00
Shipping: Free
Hisense BSA66346PDBGUK Built In Single Electric Oven -Black 3364798
Hisense BSA66346PDBGUK Built In Single Electric Oven -Black 3364798
This Hisense Built In Single Oven suits families needing ample cooking space and smart control, with a 77l capacity and Wi-Fi via the Connect Life app to preheat remotely or monitor dinner anywhere. The multifunction design offers 22 automatic programmes plus Air Fry for crispy chips and wings with minimal oil, Pizza Mode, and Steam Add Plus for perfect bakes. With 5 shelf positions, you can cook multiple dishes at once, and the full-width electric grill handles everything from loaded veg trays to melting cheese on top. The full touch control interface with jet black LED display makes navigating settings straightforward, and the quadruple-glazed door keeps heat locked in while staying cool to the touch. Pyrolytic self-cleaning turns grease into ash at high temperature, so maintenance is practically done for you. It fits standard 60cm apertures, works under your worktop or at eye level, and needs hardwiring into a cooker point. With 1.03kWh consumption, a child lock, and a 2-year manufacturer's guarantee, it's designed to handle family cooking without the fuss. Experience steam cooking with Steam Add Plus for perfectly baked goods. Cook up a storm with an array of functions including Air Fry and Pizza Mode or make use of the 22 automatic programmes. Effortless maintenance with Pyrolytic Self-Clean which turns grease and grime to ash by using high heat. Overview:Digital clock. Programmable digital display timer. LED display. Door window glazing: quadruple glazed. Slow cook function. Defrost function. Touch control. Front mounted controls. Main cavity:Multifunction fan oven cavity with 5 shelves. 77 litre capacity. Interior light. Main cavity door hinge position: bottom. Pyrolytic cleaning. Easy clean interior. Energy efficiency rating A+. Energy consumption 1.03kWh. Grill:Electric (full width) grill. Combined with oven. Grill tray included (no handle). Dimensions:Oven size H59.5, W59.5, D66cm. Oven to fit aperture (space required H59.5, W59.5, D56.4cm). Fits in eye level worktop. Fits under worktop. General information:Oven needs to be hard wired into a cooker point on the wall and on its own circuit. Child lock. Wi-Fi. Manufacturer's 2 year guarantee. EAN: 3838782762130.
3 to 5 day
£694.00
Shipping: Free
Refine Search
Category
Cookers
315
Built-In Ovens
261
Cookers
34
Sets
11
Built-In Steam Ovens
5
Hobs
3
Stove & Oven Accessories
1
Cooking & Grilling
52
Ovens
36
Pizza Ovens
13
Accessories
3
Kitchen Utensils
6
Steamers
3
Miscellaneous
2
Deep Fryers
1
Microwaves
4
Without Grill
3
With Grill
1
Tableware
2
Pans
2
Garden
1
Fire Pits
1
Toys
1
Role Play Toys
1
Miscellaneous A-Z
1
Miscellaneous S
1
Price
-
Brand
AEG
52
Amica
6
Ariete
3
Beko
29
Blomberg
1
Bosch
3
Bosch Hausgeräte
14
Cadac
3
Candy
10
Caso
1
Constructa
1
CookKing
1
Cozze
2
Daewoo
4
Delonghi
1
Dualit
1
electrolux
2
Fisher & Paykel
1
G3 Ferrari
2
Gorenje
1
Haier
7
Hisense
40
HOMCOM
8
Hoover
16
Hotpoint
28
Indesit
18
Kaiser
11
Klarstein
8
Midea
3
Miele
7
Moulinex
1
Nedis
1
Neff
18
New Classic Toys
1
Ninja
1
OneConcept
1
Ooni
1
Royal Catering
3
Russell Hobbs
14
Samsung
17
Severin
2
Siemens Hausgeräte
3
Smeg
24
Steba
1
Stoves
1
Teka
1
TV Das Original
1
TZS First Austria
1
UNOLD
2
Whirlpool
2
Woll
2
Seller
aeg.co.uk (home appliances)
2
amazon
203
amazon marketplace
1,558
ao.com
686
appliances direct
220
argos
380
blumfeldt europe
1
boots kitchen appliances
339
brooklands kitchens
9
buyitdirect
187
currys
385
debenhams uk
50
ebay
662
electricshop
196
hughes uk
64
joybuy
39
ninja uk
4
onbuy
1,095
qvc
1
samsung
5
shein uk
5
the range
26
travis perkins
10
wayfair uk
27
wilko
76
Filters
Clear All
Category
Price
Brand
0
Seller
0
Category
Cookers
315
Built-In Ovens
261
Cookers
34
Sets
11
Built-In Steam Ovens
5
Hobs
3
Stove & Oven Accessories
1
Cooking & Grilling
52
Ovens
36
Pizza Ovens
13
Accessories
3
Kitchen Utensils
6
Steamers
3
Miscellaneous
2
Deep Fryers
1
Microwaves
4
Without Grill
3
With Grill
1
Tableware
2
Pans
2
Garden
1
Fire Pits
1
Toys
1
Role Play Toys
1
Miscellaneous A-Z
1
Miscellaneous S
1
Price
-
Brand
AEG
52
Amica
6
Ariete
3
Beko
29
Blomberg
1
Bosch
3
Bosch Hausgeräte
14
Cadac
3
Candy
10
Caso
1
Constructa
1
CookKing
1
Cozze
2
Daewoo
4
Delonghi
1
Dualit
1
electrolux
2
Fisher & Paykel
1
G3 Ferrari
2
Gorenje
1
Haier
7
Hisense
40
HOMCOM
8
Hoover
16
Hotpoint
28
Indesit
18
Kaiser
11
Klarstein
8
Midea
3
Miele
7
Moulinex
1
Nedis
1
Neff
18
New Classic Toys
1
Ninja
1
OneConcept
1
Ooni
1
Royal Catering
3
Russell Hobbs
14
Samsung
17
Severin
2
Siemens Hausgeräte
3
Smeg
24
Steba
1
Stoves
1
Teka
1
TV Das Original
1
TZS First Austria
1
UNOLD
2
Whirlpool
2
Woll
2
Seller
aeg.co.uk (home appliances)
2
amazon
203
amazon marketplace
1,558
ao.com
686
appliances direct
220
argos
380
blumfeldt europe
1
boots kitchen appliances
339
brooklands kitchens
9
buyitdirect
187
currys
385
debenhams uk
50
ebay
662
electricshop
196
hughes uk
64
joybuy
39
ninja uk
4
onbuy
1,095
qvc
1
samsung
5
shein uk
5
the range
26
travis perkins
10
wayfair uk
27
wilko
76

Related Searches

mozilla/5.0 applewebkit/537.36 (khtml, like gecko; compatible; claudebot/1.0; [email protected])
x-pixel