Sorry, nothing was found. Please change your selection and try again.

Aeg Oven Accessories

(81 - 120 of 190 results)

Filters

Best Match

AEG DCE531160B Built In Electric Double Oven -

This AEG DCE531160B Built In Electric Double Oven - Black - A/A Rated is designed to provide reliable performance and practical everyday use. Built...

£1,188.89

Shipping: Free

Go to Shop

OnBuy

AEG Combination Oven & Microwave Magnetron KM4400021M KM5840300M 5550304009-86

AEG Combination Oven & Microwave Magnetron KM4400021M KM5840300M, Home, Furniture & DIY > Appliances > Cookers, Ovens & Hobs > Cooking Appliance Parts

£61.95

Shipping: Free

Go to Shop

eBay - shop4spares

AEG Oven Front Glass 594mm X 470mm BPK535120M 140037378043-11

AEG Oven Front Glass 594mm X 470mm BPK535120M, Home, Furniture & DIY > Appliances > Cookers, Ovens & Hobs > Cooking Appliance Parts

£164.05

Shipping: Free

Go to Shop

eBay - shop4spares

AEG Built In Double Cooker Top or Bottom Oven Door Handle Inox Stainless GENUIN 5614713039-13

AEG Built In Double Cooker Top or Bottom Oven Door Handle Inox Stainless GENUIN, Home, Furniture & DIY > Appliances > Cookers, Ovens & Hobs > Cooking Appliance Parts

£64.95

Shipping: Free

Go to Shop

eBay - shop4spares

AEG Combination Oven & Microwave Magnetron BHB9000QM BO4BEMGM 5550304009-79

AEG Combination Oven & Microwave Magnetron BHB9000QM BO4BEMGM, Home, Furniture & DIY > Appliances > Cookers, Ovens & Hobs > Cooking Appliance Parts

£61.95

Shipping: Free

Go to Shop

eBay - shop4spares

AEG Combination Oven & Microwave Magnetron KM8403101B KM8403101M 5550304009-89

AEG Combination Oven & Microwave Magnetron KM8403101B KM8403101M, Home, Furniture & DIY > Appliances > Cookers, Ovens & Hobs > Cooking Appliance Parts

£61.95

Shipping: Free

Go to Shop

eBay - shop4spares

AEG Oven Front Glass 594mm X 470mm BSK874320M 140037378043-59

AEG Oven Front Glass 594mm X 470mm BSK874320M, Home, Furniture & DIY > Appliances > Cookers, Ovens & Hobs > Cooking Appliance Parts

£164.05

Shipping: Free

Go to Shop

eBay - shop4spares

AEG Built In Single Electric Oven Cooker Outer Front Door Glass 5611824029-0

AEG Built In Single Electric Oven Cooker Outer Front Door Glass, Home, Furniture & DIY > Appliances > Cookers, Ovens & Hobs > Cooking Appliance Parts

£152.00

Shipping: Free

Go to Shop

eBay - shop4spares

AEG Built In Double Cooker Top or Bottom Oven Door Handle Inox Stainless GENUIN 5614713039-3

AEG Built In Double Cooker Top or Bottom Oven Door Handle Inox Stainless GENUIN, Home, Furniture & DIY > Appliances > Cookers, Ovens & Hobs > Cooking Appliance Parts

£64.95

Shipping: Free

Go to Shop

eBay - shop4spares

AEG Oven Magnetron Genuine 3878523004-1

AEG Oven Magnetron Genuine, Home, Furniture & DIY > Appliances > Cookers, Ovens & Hobs > Cooking Appliance Parts

£111.15

Shipping: Free

Go to Shop

eBay - shop4spares

AEG Built In Double Cooker Top or Bottom Oven Door Handle Inox Stainless GENUIN 5614713039-5

AEG Built In Double Cooker Top or Bottom Oven Door Handle Inox Stainless GENUIN, Home, Furniture & DIY > Appliances > Cookers, Ovens & Hobs > Cooking Appliance Parts

£64.95

Shipping: Free

Go to Shop

eBay - shop4spares

AEG OU5NP20B Built In Electric Double Oven - Black - A Rated 110747

AEG OU5NP20B Integrated Double Oven in Black

Within 7 days

£479.00

Shipping: Free

Go to Shop

ao.com

AEG Combination Oven & Microwave Magnetron GENUINE 5550304009 5550304009-93

AEG Combination Oven & Microwave Magnetron GENUINE 5550304009, Home, Furniture & DIY > Appliances > Cookers, Ovens & Hobs > Cooking Appliance Parts

£61.95

Shipping: Free

Go to Shop

eBay - shop4spares

AEG Built In Double Cooker Top or Bottom Oven Door Handle Inox Stainless GENUIN 5614713039-11

AEG Built In Double Cooker Top or Bottom Oven Door Handle Inox Stainless GENUIN, Home, Furniture & DIY > Appliances > Cookers, Ovens & Hobs > Cooking Appliance Parts

£64.95

Shipping: Free

Go to Shop

eBay - shop4spares

AEG Built In Double Cooker Top or Bottom Oven Door Handle Inox Stainless GENUIN 5614713039-17

AEG Built In Double Cooker Top or Bottom Oven Door Handle Inox Stainless GENUIN, Home, Furniture & DIY > Appliances > Cookers, Ovens & Hobs > Cooking Appliance Parts

£64.95

Shipping: Free

Go to Shop

eBay - shop4spares

AEG Oven Right Hand Hob Pan Support Genuine 3546353040-1

AEG Oven Right Hand Hob Pan Support Genuine, Home, Furniture & DIY > Appliances > Cookers, Ovens & Hobs > Cooking Appliance Parts

£59.85

Shipping: Free

Go to Shop

eBay - shop4spares

AEG Built In Double Cooker Top or Bottom Oven Door Handle Inox Stainless GENUIN 5614713039-23

AEG Built In Double Cooker Top or Bottom Oven Door Handle Inox Stainless GENUIN, Home, Furniture & DIY > Appliances > Cookers, Ovens & Hobs > Cooking Appliance Parts

£64.95

Shipping: Free

Go to Shop

eBay - shop4spares

AEG OS6AB50AM Built In Single Electric Oven-Stainless Steel 7767889

This AEG Built In Single Oven offers 71l of cooking space and a Food Sensor that monitors your dish from the inside, so you know when it's reached the right temperature. No guesswork, just the results you want. The multifunction design handles fan-assisted roasting to full-width grilling, with Multilevel Cooking spreading heat evenly across shelves so you can batch bake without rotating trays. The EXPlore LED display with 5 touch buttons and 2 rotary knobs makes adjusting times and temperatures easy, and the triple-glazed door keeps heat locked in while your kitchen stays cooler. With easy-clean enamel interior, Aqua Cleaning for steam-assisted maintenance, and 2 shelves included, it's built to fit into your routine without fuss. It needs hardwiring into a cooker point, fits standard 60cm apertures at 59.5cm wide, and comes with child lock, interior light, defrost function, and delayed start. At A energy efficiency with 1.09kWh consumption and a 2-year manufacturer's guarantee, it's designed to handle weeknight dinners and weekend cooking sessions with consistent, dependable results. The 6000 SenseCook multifunction oven with Food Sensor allows you to precisely monitor the cooking process and achieve the perfect results according to your personal taste. Overview:Digital clock. Programmable digital display timer. LED display. Door window glazing: triple glazed. Defrost function. Front mounted controls. Delayed start. Main cavity:Multifunction oven & grill cavity with 2 shelves. 71 litre capacity. Interior light. Main cavity door hinge position: bottom. Easy-clean enamel. Easy clean interior. Energy efficiency rating A+. Energy consumption 1.09kWh. Grill:Electric (full width) grill. Combined with oven. Dimensions:Oven size H59.4, W59.5, D56.7cm. Oven to fit aperture (space required H35.6, W47.9, D41.5cm). General information:Oven needs to be hard wired into a cooker point on the wall and on its own circuit. Child lock. Manufacturer's 2 year guarantee. EAN: 7333394111230.

3 to 5 day

£399.00

Shipping: £9.95

Go to Shop

Argos

AEG Oven Front Glass 594mm X 470mm GB6080P 140037378043-66

AEG Oven Front Glass 594mm X 470mm GB6080P, Home, Furniture & DIY > Appliances > Cookers, Ovens & Hobs > Cooking Appliance Parts

£164.05

Shipping: Free

Go to Shop

eBay - shop4spares

source: ao.com

AEG 6000 Series OU5NU20M

Built-In Double OvenIntegrated Microwave: NoCooking Functions: Bottom Heat, Conventional Cooking, Defrost, Grill, Light, Moist Fan Baking, Pizza Setting, True Fan Cooking, Turbo GrillingCapacity: 45 LDisplay: YesTouch Controls: YesTimer: YesEasy-Clean System: YesWi-Fi Connectivity: NoAccessories: 1 Chromed Wire Shelf, 2 Additional Chromed Shelves, Grey Enamel Dripping Pan, Chromed Trivet

£433.00

Compare 9 Prices

AEG 6000 Series Integrated Built-In Oven OU5CP40M, 61 L Capacity, Surr

AEG 6000 Series Integrated Built-In Oven OU5CP40M, 61 L Capacity, SurroundCook Fan Cooking, Catalytic Cleaning, EXPlore LED Touch Display, 50-300C,

£732.71

Shipping: £2.99

Go to Shop

OnBuy

Aeg OU5NP20B Electric Built-in Double Oven - Black, Black 10305530

This AEG OU5NP20B Electric Built-in Double Oven is ideal for anyone who enjoys cooking family favourites and larger meals from scratch. Its two spacious cavities let you tackle different dishes at different temperatures at the same time. Perfect for the Sunday roast and all the trimmings. The Hot Air convection system circulates heat evenly throughout the oven. It means everything cooks thoroughly and can even reduce cooking temperatures by up to 20%. And the enamel oven interior makes it easier to wipe away grease and food residue, helping keep cleaning simple.Full-width grill - browns and crisps food without extra appliancesDouble-glazed door - retains heat while keeping the outer surface coolerLED display and minute minderInterior lightingRetractable dials _________________________________________PLEASE NOTE:ELECTRICAL INSTALLATION: This product requires professional installation to a dedicated cooker circuit (identified by a big red cooker switch) by a qualified installer, such as one of our Tech Experts.

"1 to 3 days"

£479.00

Shipping: £5.99

Go to Shop

Currys

AEG Built In Double Cooker Top or Bottom Oven Door Handle Inox Stainless GENUIN 5614713039-9

AEG Built In Double Cooker Top or Bottom Oven Door Handle Inox Stainless GENUIN, Home, Furniture & DIY > Appliances > Cookers, Ovens & Hobs > Cooking Appliance Parts

£64.95

Shipping: Free

Go to Shop

eBay - shop4spares

AEG 6000 Series OU5NP20M Built-In Electric Double Oven - Stainless Steel

Double oven - double dishes for double deliciousEffortlessly cook two meals at once. With the Double Oven you have the choice of fan cooking conventional cooking and grilling. Giving you two separate areas where you can choose to bake or roast two dishes at the same time Expect even every timeThe golden brown on a potato gratin. The deep crust on a fillet of beef. The moist depths of a rich chocolate cake. Achieving even results time after time demands precisely controlled heat distributed consistently throughout your oven. Unlike standard ovens the SurroundCook® oven’s advanced fan technology ensures that every An at-a-glance overview of the status of your dishThe timer display provides an at-a-glance overview of the status of your dish. Its clear screen enables you to set an alarm check directly on the time remaining before your dish is ready and adjust the timer with accuracy and precision. Cooked evenly everywhereWith this oven using energy efficiently also means cooking efficiently. It has a new convection system called SurroundCook which ensures hot air circulates evenly throughout the oven cavity. The result is that the oven heats up faster and cooking temperatures can be reduced by up to 20% saving you both time and energy A quicker way to toast and crispThis highly efficient grill takes less time than traditional ovens and will toast crisp or brown your dishes to precision. An accessible ovenThis oven is designed with accessibility in mind; the trays can be inserted quickly and smoothly into the racks. Key Features . Double oven - double dishes for double delicious66L capacity main fan oven42L capacity top oven and grillLED digital displayDigital timerRetractable controlsDimensions (mm) H888 x W594 x D5682-year warranty. .

£549.00

Shipping: Free

Go to Shop

Appliances Direct

AEG Built In Double Cooker Top or Bottom Oven Door Handle Inox Stainless GENUIN 5614713039-1

AEG Built In Double Cooker Top or Bottom Oven Door Handle Inox Stainless GENUIN, Home, Furniture & DIY > Appliances > Cookers, Ovens & Hobs > Cooking Appliance Parts

£64.95

Shipping: Free

Go to Shop

eBay - shop4spares

AEG BPK355061B Built In Single Oven Electric - Black

AEG BPK355061B Built In Single Oven Electric - Black, Home, Furniture & DIY > Kitchen > Other Kitchen

£299.00

Shipping: £2.99

Go to Shop

eBay - atlantic-electrics

AEG Built In Double Cooker Top or Bottom Oven Door Handle Inox Stainless GENUIN 5614713039-19

AEG Built In Double Cooker Top or Bottom Oven Door Handle Inox Stainless GENUIN, Home, Furniture & DIY > Appliances > Cookers, Ovens & Hobs > Cooking Appliance Parts

£64.95

Shipping: Free

Go to Shop

eBay - shop4spares

source: Amazon

AEG 6000 Series OU5NP20M

Built-In Electric Double OvenIntegrated Microwave: NoCooking Functions: Fan Cooking, Conventional Cooking, GrillingCapacity: 66 LDisplay: YesTimer: YesAccessories: 2 Chromed Wire Shelves, Trivet, Black Enamel Dripping PanPyrolytic Cleaning: NoDimensions: W594 mm x D568 mm x H888 mm

£549.00

Compare 10 Prices

AEG Built In Double Cooker Top or Bottom Oven Door Handle Inox Stainless GENUIN 5614713039-20

AEG Built In Double Cooker Top or Bottom Oven Door Handle Inox Stainless GENUIN, Home, Furniture & DIY > Appliances > Cookers, Ovens & Hobs > Cooking Appliance Parts

£64.95

Shipping: Free

Go to Shop

eBay - shop4spares

AEG Built In Double Cooker Top or Bottom Oven Door Handle Inox Stainless GENUIN 5614713039-18

AEG Built In Double Cooker Top or Bottom Oven Door Handle Inox Stainless GENUIN, Home, Furniture & DIY > Appliances > Cookers, Ovens & Hobs > Cooking Appliance Parts

£64.95

Shipping: Free

Go to Shop

eBay - shop4spares

AEG Oven Front Glass Silver Stainless Steel Genuine 140052748013-0

AEG Oven Front Glass Silver Stainless Steel Genuine, Home, Furniture & DIY > Appliances > Cookers, Ovens & Hobs > Cooking Appliance Parts

£130.10

Shipping: Free

Go to Shop

eBay - shop4spares

AEG 3000 Series Integrated Oven with AirFry BEX535A61B,

This AEG 3000 Series Integrated Oven with AirFry BEX535A61B, 72L, Fast Heat Up, Multilevel Cooking, Turbo Grill, Fan Controlled Defrosting, Aqua...

£660.29

Shipping: Free

Go to Shop

OnBuy

AEG Oven Magnetron Genuine 5550304009-1

AEG Oven Magnetron Genuine, Home, Furniture & DIY > Appliances > Cookers, Ovens & Hobs > Cooking Appliance Parts

£61.95

Shipping: Free

Go to Shop

eBay - shop4spares

AEG BPX535061M Built In Single Electric Oven-Stainless Steel 2154370

This AEG Built In Single Oven is designed for serious home cooking, with a 72l capacity and multifunction settings for roasting, baking or grilling. The Hot Air system with an extra heating ring ensures even cooking across multiple levels for consistent results. The pyrolytic cleaning converts grease and residue into ash for easy wiping. The Explore LED display with touch buttons offers clear control over time and temperature, making adjustments straightforward. With dial controls, triple-glazed door, programmable digital timer, and an interior light, it handles everyday cooking without fuss. It comes with 3 shelves, a full-width electric grill, grill tray and handle, plus a child lock for added safety. The oven needs hardwiring into a cooker point, fits standard 60cm apertures (H60, W56, D55cm required), and the easy-clean interior combined with pyrolytic cleaning means minimal maintenance. At A energy rating and 0.93kWh consumption, it's efficient to run, and it's backed by a 2-year manufacturer's guarantee. Multi level Cooking – cook dishes evenly with this oven thanks to an additional heating ring element. Overview:Digital clock. Programmable digital display timer. LED display. Door window glazing: triple glazed. Defrost function. Dial control. Front mounted controls. Main cavity:Multifunction oven & grill cavity with 3 shelves. 72 litre capacity. Interior light. Main cavity door hinge position: bottom. Pyrolytic cleaning. Easy clean interior. Energy efficiency rating A+. Energy consumption 0.93kWh. Grill:Electric (full width) grill. Combined with oven. Grill tray and handle included. Dimensions:Oven size H59.4, W59.4, D56.9cm. Oven to fit aperture (space required H60, W56, D55cm). General information:Oven needs to be hard wired into a cooker point on the wall and on its own circuit. Child lock. Manufacturer's 2 year parts and labour guarantee. EAN: 7333394055008.

3 to 5 day

£564.00

Shipping: £9.95

Go to Shop

Argos

AEG Built-In Double Electric Oven Fan Oven S/Steel DEX33111EM

Diamond-glazedEnamelInterior:Asmoothenamelinteriorforeaseofcleaning,cookingresiduescanbeeasilywipedawayimmediatelyaftercooking.

£479.00

Shipping: Free

Go to Shop

OnBuy

Air Fryer Rotisserie Oven Basket Grill Roaster Accessories, 30cm

Features 1. 360 degree rotating design: The rotating baking cage is designed with a rotating part inside, which can achieve the purpose of stirring...

£61.16

Shipping: Free

Go to Shop

OnBuy

AEG DCE731110M

Built-in ovenIntegrated Microwave: NoEnergy Rating: ACapacity: 39/61 LEasy-Clean System: YesPyrolytic Cleaning: NoHeat Protection Window: YesDimensions: H888 mm x W594 mm x D568 mm

£609.99

Shipping: £60.00

Go to Shop

eBay - lottsforyoulimited

AEG Built in Single Oven Inner Back Door Glass GENUINE 3302413012-2

AEG Built in Single Oven Inner Back Door Glass GENUINE, Home, Furniture & DIY > Appliances > Cookers, Ovens & Hobs > Cooking Appliance Parts

£77.90

Shipping: Free

Go to Shop

eBay - shop4spares

AEG DCB331010M Built-In Electric Double Oven Stainless Steel

1-3 Days