Sorry, nothing was found. Please change your selection and try again.
Aeg Oven Accessories
(81 - 120 of 199 results)
Filters
Best Match
Best Match
Price: Low to high
Price: High to low
source: Amazon
AEG 6000 Series OU5NU20M
Built-In Double OvenIntegrated Microwave: NoCooking Functions: Bottom Heat, Conventional Cooking, Defrost, Grill, Light, Moist Fan Baking, Pizza Setting, True Fan Cooking, Turbo GrillingCapacity: 45 LDisplay: YesTouch Controls: YesTimer: YesEasy-Clean System: Yes
£549.00
AEG Built In Single Oven Inner Door Glass 524 x 402mm GENUINE 140157332010-0
AEG Built In Single Oven Inner Door Glass 524 x 402mm GENUINE, Home, Furniture & DIY > Appliances > Cookers, Ovens & Hobs > Cooking Appliance Parts
£135.40
Shipping: Free
eBay - shop4spares
AEG Lampe 8087690031 Oven LSP8087690031
AEG Lampe 8087690031 Oven
£62.10
Shipping: Free
Amazon Marketplace - Groupe Dragon
AEG Combination Oven & Microwave Magnetron BO4GEMKM BO4MGM 5550304009-80
AEG Combination Oven & Microwave Magnetron BO4GEMKM BO4MGM, Home, Furniture & DIY > Appliances > Cookers, Ovens & Hobs > Cooking Appliance Parts
£61.95
Shipping: Free
eBay - shop4spares
AEG OU5NP20B 66L Double Built In Oven - Black
AEG OU5NP20B 66L Double Built In Oven - Black, Home, Furniture & DIY > Appliances > Cookers, Ovens & Hobs > Ovens
£549.99
Shipping: £9.99
Energy Rating: A+
eBay - atlantic-electrics
AEG Combination Oven & Microwave Magnetron BHB9000QM BO4BEMGM 5550304009-79
AEG Combination Oven & Microwave Magnetron BHB9000QM BO4BEMGM, Home, Furniture & DIY > Appliances > Cookers, Ovens & Hobs > Cooking Appliance Parts
£61.95
Shipping: Free
eBay - shop4spares
AEG Compact Oven With Microwave Function, Black, A+ Rated - TK6NK501B
Capacity (Usable Litres) - 44
Electrical Connection - Hard-wired
Connectivity: Control your oven via your smartphone or tablet
Electronic touch controls
Product Dimensions (HxWxD) (mm) - 455 x 595 x 567
Next day delivery available
£649.00
Shipping: Free
Marks Electrical
AEG Built In Single Oven Inner Back Door Glass 524 X 402mm 5611831024-2
AEG Built In Single Oven Inner Back Door Glass 524 X 402mm, Home, Furniture & DIY > Appliances > Cookers, Ovens & Hobs > Cooking Appliance Parts
£83.95
Shipping: Free
eBay - shop4spares
AEG GU5CP20M Built-In Electric Double Oven, Stainless Steel, A Rated
Capacity (Usable Litres) - 42/61
Electrical Connection - Hard-wired
LED digital display: Clear information at a glance with the LED display.
Isofront double-glazed doors with a heat reflective coating.
Product Dimensions (HxWxD) (mm) - 888 x 594 x 568 (excluding handle and door)
Next day delivery available
£549.99
Shipping: Free
Energy Rating: A
Marks Electrical
AEG Built In Double Cooker Top or Bottom Oven Door Handle Inox Stainless GENUIN 5614713039-10
AEG Built In Double Cooker Top or Bottom Oven Door Handle Inox Stainless GENUIN, Home, Furniture & DIY > Appliances > Cookers, Ovens & Hobs > Cooking Appliance Parts
£64.95
Shipping: Free
eBay - shop4spares
AEG Oven Front Glass 594mm X 470mm BPK535120M 140037378043-11
AEG Oven Front Glass 594mm X 470mm BPK535120M, Home, Furniture & DIY > Appliances > Cookers, Ovens & Hobs > Cooking Appliance Parts
£164.05
Shipping: Free
eBay - shop4spares
AEG OU5NU20B Built-Under Electric Double Oven, Black, A Rated
Capacity (Usable Litres) - 42/45
Electrical Connection - Hard-wired
Electronic touch controls.
Cooling fan
Product Dimensions (HxWxD) (mm) - 715 x 594 x 568
Next day delivery available
£549.00
Shipping: Free
Energy Rating: A
Marks Electrical
AEG Oven Front Glass 594mm X 470mm BSK874320M 140037378043-59
AEG Oven Front Glass 594mm X 470mm BSK874320M, Home, Furniture & DIY > Appliances > Cookers, Ovens & Hobs > Cooking Appliance Parts
£164.05
Shipping: Free
eBay - shop4spares
AEG Compact Oven With Microwave Function, Black, A Rated - TK8NK721T
Capacity (Usable Litres) - 44
Electrical Connection - Hard-wired
Microwave and Oven. Dual functions for delicious dishes
CookSmart Touch. Smart cooking at your fingertips
Product Dimensions (HxWxD) (mm) - 455 x 595 x 567
Next day delivery available
£824.00
Shipping: Free
Marks Electrical
AEG Oven Front Glass 594mm X 470mm BPK642120M 140037378043-37
AEG Oven Front Glass 594mm X 470mm BPK642120M, Home, Furniture & DIY > Appliances > Cookers, Ovens & Hobs > Cooking Appliance Parts
£164.05
Shipping: Free
eBay - shop4spares
AEG Oven Right Hand Hob Pan Support Genuine 3546353040-1
AEG Oven Right Hand Hob Pan Support Genuine, Home, Furniture & DIY > Appliances > Cookers, Ovens & Hobs > Cooking Appliance Parts
£59.85
Shipping: Free
eBay - shop4spares
AEG Combination Oven & Microwave Magnetron GENUINE 5550304009 5550304009-93
AEG Combination Oven & Microwave Magnetron GENUINE 5550304009, Home, Furniture & DIY > Appliances > Cookers, Ovens & Hobs > Cooking Appliance Parts
£61.95
Shipping: Free
eBay - shop4spares
source: Marks Electrical
AEG BCX23101EM
Built-in OvenIntegrated Microwave: NoEnergy Rating: ACooking Functions: Baking, Roasting, GrillingCapacity: 65 LTouch Controls: YesEasy-Clean System: YesPyrolytic Cleaning: No
£269.99
AEG Combination Oven & Microwave Magnetron BFB9000QM BHB5000QM 5550304009-77
AEG Combination Oven & Microwave Magnetron BFB9000QM BHB5000QM, Home, Furniture & DIY > Appliances > Cookers, Ovens & Hobs > Cooking Appliance Parts
£61.95
Shipping: Free
eBay - shop4spares
source: Amazon
AEG 6000 Series OU5NP20M
Built-In Electric Double OvenIntegrated Microwave: NoCooking Functions: Fan Cooking, Conventional Cooking, GrillingCapacity: 66 LDisplay: YesTimer: YesAccessories: 2 Chromed Wire Shelves, Trivet, Black Enamel Dripping PanPyrolytic Cleaning: No
£549.00
AEG Built-In Double Electric Oven Fan Oven S/Steel DEX33111EM
Diamond-glazedEnamelInterior:Asmoothenamelinteriorforeaseofcleaning,cookingresiduescanbeeasilywipedawayimmediatelyaftercooking.
£479.00
Shipping: Free
OnBuy
sparefixd Top Oven Inner Door Glass for AEG Built in Double Oven RAN3872587021-1
Oven Inner Door Glass Equivalent to Part Number 3872587021 See description below for full list of models this part fits. For cookers and ovens the model number is usually found inside the door on the main body of the cooker. It can sometimes be hidden behind the door seal, and it is normally found towards the bottom. Where the hob is separate, the model number is normally found on the underside of the hob. You may be able to get access by removing the oven from the unit, if built in underneath. D31016B, D31016B, D31016M, D31016M, D31016W, D31016W, D41116M, D41116M, D41116M, D88106M, D88106M, D88106M, DC4003000M, DC4003020M, DC4013001M, DC4013021M, DC7003000M, DC7013001M, DC7013021M, DC7013101M, DCB331010M, DCE731110M, DCK431110M, DCK731110M, DCS431110M, DE3004021M, DE4003000B, DE4003000M, DE4003020M, DE4013001M, DE401301DM, DE4013021M, DE401302DM, DE401303DM, DE4043001B, DEB331010M, DEE431010B, DEK431010M, DES431010M, Manufacturer: Sparefixd
£66.20
Shipping: Free
Amazon Marketplace - Shop4Spares
source: Boots Kitchen Appliances
AEG DCE731110M
Built-in ovenIntegrated Microwave: NoEnergy Rating: ACapacity: 39/61 LEasy-Clean System: YesPyrolytic Cleaning: NoHeat Protection Window: YesDimensions: H888 mm x W594 mm x D568 mm
£619.99
AEG Built in Single Oven Inner Back Door Glass GENUINE 3302413012-2
AEG Built in Single Oven Inner Back Door Glass GENUINE, Home, Furniture & DIY > Appliances > Cookers, Ovens & Hobs > Cooking Appliance Parts
£77.90
Shipping: Free
eBay - shop4spares
AEG SurroundCook BEX335011M Electric Oven - Stainless Steel, Stainless Steel 10261421
Take your baking from bland to grand with this AEG oven. The SurroundCook convection system blows hot air around the whole oven, so every meal is cooked evenly. Thanks to its fan technology, you'll get a perfect golden brown finish on your pies and roasts - every part of your dish gets the heat it needs. You can also bake large batches of sweet treats with its XL baking tray that is 20% larger than the usual ones. And finally, when you're done, Aqua Clean makes it effortless to wipe away those greasy residues using steam - no elbow grease required.Good to know- The Hot Air convection is so efficient that the oven heats up really quickly, saving you time and energy- The LED display with touch control gives you quick access to all the cooking functions- Cook the perfect cheese on toast or crispy bacon in the full width grill_________________________________________PLEASE NOTE:ELECTRICAL INSTALLATION: This product requires professional installation to a 13 Amp fused spur by a qualified installer, such as one of our Tech Experts.
"1 to 3 days"
£299.00
Shipping: £45.00
Currys
source: Hughes UK
AEG BPS355061M
Built-in OvenIntegrated Microwave: NoEnergy Rating: A+Cooking Functions: Multifunction, Grill FunctionCapacity: 71 LWi-Fi Connectivity: NoDimensions: W59.50 cm x D56.70 cm x H59.40 cm
£499.99
AEG DCE531160B 6000 Series Electric Built-In Double Oven - Black
. The golden brown on a potato gratin. The deep crust on a fillet of beef. The moist depths of a rich chocolate cake. Achieving even results time after time demands precisely controlled heat distributed consistently throughout your oven. Unlike standard ovens the SurroundCook oven’s advanced fan technology ensures that every part of your dish is getting exactly the heat it needs. Evenly. Consistently. Wherever it’s placed. Whether it’s one dish or several. No more turning dishes halfway through cooking. Just the results that meet your expectations. Every time. Key features . Double oven - double dishes for double deliciousHeat activated catalytic cleaning makes cleaning the oven so much easierEffortless control. EXPlore LED Display with Touch buttonsCooked Evenly everywhereA quicker way to toast and crisp61L main 43L top oven capacitiesIncludes modes such as pizzaIsofront® double glazed door . Double oven - double dishes for double deliciousEffortlessly cook two meals at once. With the Double Oven you have the choice of fan cooking conventional cooking and grilling. Giving you two separate areas where you can chose to bake or roast two dishes at the same time. Heat activated catalytic cleaningThe catalytic lining absorbs the grease from cooking and is activated by regular heating to 220°C. The grease residue is oxidised leaving the catalytic surface clean. Effortless control. EXPlore LED Display with Touch buttonsExplore a new way to experience your oven with the responsive EXPlore LED Display with touch buttons. The vibrant interface gives you quick access and dynamic control of cooking time temperature and other features. Cooked evenly everywhereWith this oven using energy efficiently also means cooking efficiently. It has a new convection system called SurroundCook which ensures hot air circulates evenly throughout the oven cavity. The result is that the oven heats up faster and cooking temperatures can be reduced by up to 20% saving you both time and energy A quicker way to toast and crispThis highly efficient grill takes less time than traditional ovens and will toast crisp or brown your dishes to precision..
£599.00
Shipping: Free
Appliances Direct
AEG Oven Magnetron Genuine 3878523004-1
AEG Oven Magnetron Genuine, Home, Furniture & DIY > Appliances > Cookers, Ovens & Hobs > Cooking Appliance Parts
£111.15
Shipping: Free
eBay - shop4spares
AEG BPK355061B Built In Single Oven Electric - Black
AEG BPK355061B Built In Single Oven Electric - Black, Home, Furniture & DIY > Kitchen > Other Kitchen
£350.00
Shipping: £9.99
eBay - atlantic-electrics
AEG Oven Front Glass 594mm X 470mm BPK531120M 140037378043-10
AEG Oven Front Glass 594mm X 470mm BPK531120M, Home, Furniture & DIY > Appliances > Cookers, Ovens & Hobs > Cooking Appliance Parts
£164.05
Shipping: Free
eBay - shop4spares
AEG Built In Combi Microwave Oven Front Outer Door Glass & Frame GENUINE 5616265038-0
AEG Built In Combi Microwave Oven Front Outer Door Glass & Frame GENUINE, Home, Furniture & DIY > Appliances > Cookers, Ovens & Hobs > Cooking Appliance Parts
£119.95
Shipping: Free
eBay - shop4spares
AEG Oven Front Glass Silver Stainless Steel Genuine 140052748013-0
AEG Oven Front Glass Silver Stainless Steel Genuine, Home, Furniture & DIY > Appliances > Cookers, Ovens & Hobs > Cooking Appliance Parts
£130.10
Shipping: Free
eBay - shop4spares
AEG BEX33501EB 59.4cm Built In Electric Single Oven - Black
AEG BEX33501EB 59.4cm Built In Electric Single Oven - Black is a premium-quality product designed to meet everyday home, DIY, and professional needs.
£634.90
Shipping: £20.00
OnBuy
AEG Built-In Combination Microwave Oven, Stainless Steel - KMX365060M
Capacity (Usable Litres) - 43
Power Output - 1700 W
All the taste, Half the time - A succulent roast chicken, a creamy Dauphinoise, a rich beef casserole
Microwave-grill combination
Product Dimensions (HxWxD) (mm) - 455 x 595 x 567
Next day delivery available
£585.00
Shipping: Free
Marks Electrical
AEG Oven Front Glass Genuine 5612574052-0
AEG Oven Front Glass Genuine, Home, Furniture & DIY > Appliances > Cookers, Ovens & Hobs > Cooking Appliance Parts
£129.95
Shipping: Free
eBay - shop4spares
AEG DCE531160B Built In Electric Double Oven -
This AEG DCE531160B Built In Electric Double Oven - Black - A/A Rated is designed to provide reliable performance and practical everyday use. Built...
£1,188.89
Shipping: £20.00
OnBuy
AEG 6000 Series OU5CP40M
Built-In Electric Double OvenIntegrated Microwave: NoCooking Functions: Bottom Heat, Conventional Cooking, Defrost, Frozen Foods, Grill, Moist Fan Baking, Pizza Setting, True Fan Cooking, Turbo GrillingCapacity: 61 LDisplay: YesTouch Controls: YesEasy-Clean System: YesWi-Fi Connectivity: No
£569.00
AEG BES35501EM 62.5cm Built In Electric Single Oven
This AEG BES35501EM 62.5cm Built In Electric Single Oven Stainless Steel is designed to provide reliable performance and practical everyday use.
£1,236.51
Shipping: £20.00
OnBuy
AEG-Electrolux AEG Cooker Main Oven Dual Grill Heating Element 140053708131 1050W/1900W
AEG Cooker Main Oven Dual Grill Heating Element 140053708131 1050W/1900W, Home, Furniture & DIY > Appliances > Cookers, Ovens & Hobs > Cooking Appliance Parts
£81.99
Shipping: Free
Base price: £81.99 / Unit
eBay - awspares
AEG Combination Oven & Microwave Magnetron BBB8000QB BBB9000QB 5550304009-75
AEG Combination Oven & Microwave Magnetron BBB8000QB BBB9000QB, Home, Furniture & DIY > Appliances > Cookers, Ovens & Hobs > Cooking Appliance Parts
£61.95
Shipping: Free
eBay - shop4spares
Refine Search
Filters
Clear All
Category
✓Price
✓Brand
0Seller
0