Sorry, nothing was found. Please change your selection and try again.
Portable Pressure Washers
(441 - 480 of 1,272 results)
Filters
Best Match
Best Match
Price: Low to high
Price: High to low
Unbranded (Pressure Washer(2 Batteries)) Cordless Pressure Washer,21V 45 Bar/652 PSI Portable Pressure Washer with 3.0Ah Battery,6-in-1 Adjustable Nozzle,16.4FT
Aboutthisitem ...
£63.98
Shipping: Free
OnBuy
Unbranded High Pressure Water Pump Diaphragm Pump 12V Portable Pressure Washer Car Seat Gap Filler Multifunctional Car Organizer With Adjustable Aperture Energy
Engineered for versatility and efficiency, this high-pressure water pump combines innovation with practicality. Designed as a diaphragm pump 12V, it...
£98.08
Shipping: Free
OnBuy
Unbranded 220V Household Pressure Pump Portable Car Washer Sprayer Pressure Washer Pump Cleaning Machine
This 220V household pressure pump washer cleaning machine is designed for home use, delivering pressure cleaning in a compact, portable form. The...
£311.81
Shipping: Free
OnBuy
Livingandhome Portable Gasoline Petrol Pressure Washer - Black 6631984
This is the market leader for petrol pressure washers due to their unparalleled performance and reliability. Creates high pressure output from a manoeuvrable unit thanks to its rough terrain wheels and robust handle. The sturdy, tough steel frame ensures that your pressure washer will not let you down. The extra power means that you will complete cleaning jobs faster and with low fuel consumption to keep running costs to a minimum. This pressure washer comes with a drain cleaner attachment. Simply pop it in a blocked drain and it will propel itself through the drain and blockage, clearing it on the way. Your pressure washer is suitable for use almost anywhere with the functionality to be fed with water from a tap, bucket or pond. A hose and filter system is included to keep debris out and protect the engine. Designed with durability in mind. This pressure washer has a solid steel frame and heavy duty wheels. The automatic stopstart pump ensures that you only get the water flow when you need it. This comes with an 8 meter hose and an additional 12 meter hose so you have plenty of reach. With the long reach you can spend more time cleaning and less time moving the unit.
£252.99
Shipping: Free
The Range
Unbranded Pressure Radiator Cleaning Rod 60cm Stainless Steel High Performance Portable Pressure Washer Rod for Trucks Condensers Heavy Machinery Tight Spaces
- Dual jet function allows easy switching between two water spray intensities for effective pressure washing and precise temperature control. This...
£74.23
Shipping: Free
OnBuy
Unbranded Car Pressure Washer Pump Portable High Pressure Car Washer Pump Cleaning Kit for Home Garden
1ãÂÂHigh Quality: Diaphragm pumps are made of high quality materials, resistant to acid and alkali, corrosion and pesticides, long service life and...
£52.41
Shipping: Free
OnBuy
Unbranded Car Seat Gap Filler Multifunctional Car Organizer Portable Pressure Washer Diaphragm Pump 12V High Pressure Water Pump With Self Priming Capability Ap
This car seat gap filler redefines utility with its dual role as a multifunctional car organizer and high-performance diaphragm pump 12V. Featuring...
£95.74
Shipping: Free
OnBuy
Pro-Kleen Portable Pressure Power Jet Washer - Blue 8550137
Tackle medium to heavy-duty tasks with ease, from vehicles and patios to garden walls and fences. The 5-metre pressure hose, 5-metre power cable, and quick-connect lance attachments make cleaning quicker while saving energy with its auto shut-off safety feature. Equipped with a robust 1400W motor and a high-grade aluminium water pump that resists rust and corrosion. With a max flow rate of 426L/h and a working rate of 330L/h, it's built to handle tough cleaning jobs effortlessly and last longer. Weighing just 6.5kg, this pressure washer is lightweight and easy to manoeuvre. The energy-saving auto trigger cut-off gun and lance, with quick-change spray adaptors, allow you to customize for every cleaning task. Supplied with a soft-bristle car wash brush, ideal for vehicles, caravans, boats, and windows. Its unique water flow design safely removes stubborn dirt and grime, leaving a high-quality, scratch-free finish every time. Includes a 1400W motor, 105 bar max pressure, 50oC max water temperature, turbo nozzle, adjustable spray nozzle, quick-release gun, and 5m water hose. Compact (68.5x31x26cm) and easy to store, with low noise at 91dB for added comfort. Backed by Pro-Kleen's excellent UK customer service, two-year warranty, spare parts support, and next-day replacement delivery. Enjoy peace of mind knowing your unit will perform efficiently for years to come.
£74.99
Shipping: Free
The Range
SHEIN Cordless Pressure Washer,21V Portable Pressure Washer With 2X 3.0Ah Battery,6-In-1 Adjustable Nozzle,5m Hose Pressure Cleaner sq25073102433287839
Product specifications:• Product Name: Pressure Car Wash Machine• Power: 2000W• Battery capacity: 3000mAH• Voltage: 21V• Working pressure: 1.6Mpa• Flow rate: 270L/H• Farthest spraying distance: 10 meters• Working time: 45 minutesThe packaging includes:Cordless pressure car washer * 1,Battery * 2,Fast charger *1,Six in one nozzle *1,Switch raft *1,Quick connector *1,Cola connector *1,25CM short pipe *1,5M water pipe * 1 Foam pot * 1,Woven bag * 1Product features:[POWERFUL AND EFFICIENT]This pressure car washing machine is equipped with a high-power brushless motor, which has a large water output, high pressure, stable water delivery, durability, and a maximum spraying distance of up to 10 meters. The Pressure car wash machine offer powerful motors capable of jetting up to 270L/H, delivering 130% more power than the previous generation and a relatively longer service life.The unique mechanical lock function ensures personal safety.[6-in-1 MULTI-FUNCTION NOZZLE]The cordless pressure washer offers 6 nozzle options: dot mode, fan mode, and shower mode. The battery pressure washer is additionally equipped with 0°, 15°, 25°, 45°, foam jet and shower mode. A variety of water spray modes can be used in combination to efficiently perform tasks such as cleaning, irrigating, and watering flowers. In addition, we have included a foam canister for spraying foam before cleaning.[The Power To Do More]The portable pressure cleaner provides a 3000mAh battery that lasts at least 45 minutes when fully charged with a 25V rechargeable battery; Lithium-ion battery technology, discharge without memory effect, ensure long battery life.[Cordless Design, More Portable]This high-pressure cordless washing machine Powered by high-capacity batteries, cordless design allows for easy access to water from anywhere, So the wireless car wash machine is not limited by the length of the wires and its working range, making it more convenient to work outdoors.[ Efficient Filtration To Protect The Machine]Portable self starting device, faster and stronger. This high-pressure car wash machine is equipped with a stainless steel fine filter, which can effectively deeply filter impurities in water, without damaging the car paint, and effectively isolate sediment, blade residue, and dust,providing a thorough cleaning experience, and better protect our Pressure car wash machine.[Wide Application]The Cordless portable power Washer can not only be used to clean all kinds of cars, bicycles, motorcycles, but also can be used to clean balconies, windows, floors, houses, outdoor furniture, etc. You can also use your power washer as a sprinkler in your yard and garden, cleaning dust from plants, irrigating and watering your lawn. You can also give your pet a bath after turning down the water pressure.PP
£27.72
Shipping: Free
SHEIN UK
TWSOUL Portable Ultra-Pressure Washer Elec 6-IN-1 Rotating Nozzle Touchscreen function
Portable Ultra-Pressure Washer Elec 6-IN-1 Rotating Nozzle Touchscreen function, Garden & Patio > Garden Power Tools & Equipment > Pressure Washers
£66.95
Shipping: Free
eBay - hubpannacea
12V Portable High Pressure Washer 160PSI Electric Pump Kit For Car
12V Portable High Pressure Washer 160PSI Electric Pump Kit For Car, Garden & Patio > Garden Power Tools & Equipment > Pressure Washers
£35.56
Shipping: Free
eBay - deglobaldeals
sukaudiz Portable Cordless Pressure Washer Max 45 Bar With 2 X 4000mah
Portable Cordless Pressure Washer Max 45 Bar With 2 X 4000mah Batteries, 6 In 1 Spray Nozzles,5m Hose,Soap Dispenser Bottle For Patio Cleaning and...
£177.70
Shipping: £9.99
OnBuy
CONENTOOL Portable Cordless Pressure Washer Electric High Power Jet Wash Patio Car Cleaner
Portable Cordless Pressure Washer Electric High Power Jet Wash Patio Car Cleaner, Garden & Patio > Garden Power Tools & Equipment > Pressure Washers
£25.99
Shipping: Free
eBay - xgody-neotec
Unbranded 20V Cordless Portable Pressure Cleaner Washer Car Mototcycle Courtyard Glass Cleaning
Description: 20V Cordless Portable Pressure Cleaner For Car Courtyard Glass Cleaning Specification: Voltage: 20V Max Pressure: 0.9 MPa/130 PSI Max...
£223.00
Shipping: £3.85
OnBuy
TANBURO Portable Cordless Pressure Washer Electric High Power Jet Wash Patio Car Cleaner
Portable Cordless Pressure Washer Electric High Power Jet Wash Patio Car Cleaner, Garden & Patio > Garden Power Tools & Equipment > Pressure Washers
£26.90
Shipping: Free
Base price: £26.90 / Unit
eBay - elepull6
DAYPLUS 1600PSI Electric Portable High-Pressure Washer Power Cleaner Car Washing Machine
1600PSI Electric Portable High-Pressure Washer Power Cleaner Car Washing Machine, Garden & Patio > Garden Power Tools & Equipment > Pressure Washers
£68.68
Shipping: Free
eBay - beyourfriend2017
Unbranded Cordless Portable Pressure Washer 6 in 1 Nozzles Multifunctional Power Cleaner for Car Floor Watering Cleaning 100â240V US Plug
Cordless Portable Pressure Washer 6 in 1 Nozzles Multifunctional Power Cleaner for Car Floor Watering Cleaning 100âÂÂ240V US Plug Item Type:...
£71.16
Shipping: Free
OnBuy
Unbranded High Pressure Water Pump Diaphragm Pump 12V Portable Pressure Washer Car Seat Gap Filler Multifunctional Car Organizer With Adjustable Aperture Energy
Engineered for versatility and efficiency, this high-pressure water pump combines innovation with practicality. Designed as a diaphragm pump 12V, it...
£87.68
Shipping: Free
OnBuy
Unbranded (30 Bar White Washer?1 Battery?) Cordless Pressure Washer,21V 45 Bar/652 PSI Portable Pressure Washer with 3.0Ah Battery,6-in-1 Adjustable Nozzle,16.4
Aboutthisitem ...
£69.99
Shipping: Free
OnBuy
HSHa Cordless Pressure Washer,21V 45 Bar/652 PSI Portable Pressure Washer with 2PCS 3.0Ah Battery,6-in-1 Adjustable Nozzle,5m Hose Pressure Cleaner for Ca
Cordless Pressure Washer,21V 45 Bar/652 PSI Portable Pressure Washer with 2PCS 3.0Ah Battery,6-in-1 Adjustable Nozzle,5m Hose Pressure Cleaner for...
£79.72
Shipping: Free
OnBuy
HSHa Cordless Pressure Washer,21V 45 Bar/652 PSI Portable Pressure Washer with 2PCS 3.0Ah Battery,6-in-1 Adjustable Nozzle,5m Hose Pressure Cleaner for Ca
Cordless Pressure Washer,21V 45 Bar/652 PSI Portable Pressure Washer with 2PCS 3.0Ah Battery,6-in-1 Adjustable Nozzle,5m Hose Pressure Cleaner for...
£79.83
Shipping: Free
OnBuy
SHEIN Cordless Pressure Washer,21V 45 Bar/652 PSI Portable Pressure Washer With 2PCS 3.0Ah Battery,6-In-1 Adjustable Nozzle,5m Hose Pressure Cleaner For Car/Floor/Garden Cleaning & Watering Cordless Pressure Washer,21V 45 Bar/652 PSI Portable Pressure Washer With 2PCS 3.0Ah Battery,6-In-1 Adjustable Nozzle,5m Hose Pressure Cleaner For Car/Floor/Garden Cleaning & WateringCordless Pressure Washer,21V 45 Bar/652 PSI Portable Pressure Washer With 2PCS 3.0Ah Battery,6-In-1 Adjustable Nozzle,5m Hose P
[45 Bar/652PSI High Pressure Washer]Power water gun delivers Max 45 Bar/652 PSI working pressure with max 4.5 MPA water inlet capable of spraying water up to 270L/h, which can clean stubborn stains quickly. Designed for washing car, driveway, wall, floor, pool, window and pet showering[6-in-1 Nozzle]Cordless pressure washer equipped with a 6-in-1 nozzle, it can be used in 0°, 15°, 25°, 40°, 0°Shower, and Spray mode which can catering all cleaning needs for outdoor.It can be used to water plants, clean walls, floors, bathrooms, driveways, fences, and hard-to-reach corners in both home and garden settings[Use Any Clean Water Source]1) Use water from a lake or river -You can use the pressure washer whilst out on a camping. There's also no need to worry about debris as the Mesh Filter will keep your pressure washer and whatever you're washing, safe from debris and detritus; 2) Use water from portable buckets-With its unique water extracting design, the 16.4 feet hose mean that you can use it portably without connecting a tap; 3) Use water from bottled water-Screw the bottle onto the water gun inlet for wireless water supply[2PCS 3.0AH Lithium Battery]The washer weighs approximately 2kg and is powered by 2PCS 3.0Ah battery.No wires limited with our pressure washer, you can wash wherever you want. The battery keeps for about 60 to 90 minutes depend on different water pressure.Whether you clean your car or bikes whilst on a trip or simply want to wash off your boots after a hiking trip, our pressure washer is great for taking on the go whilst still providing a high pressure clean[What You Get]Battery pressure washer portable comes with a variety of accessories, making it powerful and versatile. Package include:1 x Portable Pressure Washer;2 x 3.0 Ah Battery Pack; 1 x Fast Charger; 1 x 5m Water Hose; 1 x Multi-Spray Nozzle; 1 x Soda Bottle; 1 x Water Filter; 1 x Hose Connector; 1 x Soda Bottle Adapter;1 x Carry Bag[Friendly Tips]It is normal for there to be a small amount of water in the product. Our products are tested before leaving the factory. This does not mean that the product has been used. If you have any questions, please contact us as soon as possible.ABS
£29.24
Shipping: Free
SHEIN UK
OIMG 6-in-1 Portable Cordless Pressure Washer - High Pressure Car Wash & Garden Spray Gun
Cordless Car Washing Spray Gun: Rechargeable Cordless High Pressure Car Washer Gun takes portability and convenience into consideration, there is no...
£102.97
Shipping: £9.99
OnBuy
RayShine Portable Cordless Pressure Washer - 2 Pack Batteries 1200PSI 336l H
Enhance your travel and daily use with this portable cordless pressure engineered for practical performance and reliable results. Key details...
£88.08
Shipping: Free
OnBuy
TIHOOK Portable Pressure Jet Washer for Ma-kita BL-18V, Brushless Motor, Cordless Press
Portable Pressure Jet Washer for Ma-kita BL-18V, Brushless Motor, Cordless Press, Garden & Patio > Garden Power Tools & Equipment > Pressure Washers
£74.99
Shipping: Free
eBay - naijanded
NONE Portable Pressure Washer 5 Adapters 360 Rotating 4 Spray Patterns Garden Hose Spray Gun Car Cleaner Pet Shower Plant Watering 1005012331089441
Portable Pressure Washer 5 Adapters 360 Rotating 4 Spray Patterns Garden Hose Spray Gun Car Cleaner Pet Shower Plant Watering
£3.37
Shipping: £1.99
AliExpress UK
Unbranded Electric Washer Gun Wireless High Pressure Car Wash Water Gun Portable High Pressure Washer Foa
Brand Name: pracmanu Certification: CE Origin: CN(Origin) Wattage: 500W-799W Item Type: Car Washer Endurance: 25-35min Peak pressure: 30bar Flow...
£74.00
Shipping: £3.85
OnBuy
Unbranded Portable Wireless High-pressure Washer Portable Car Wash Garden Sprinkler OPC-PTWV6QC-NEW
Features: 1. Wireless 10000 milliampere lithium battery car washer, 30 minutes of battery life. 2.600W power powerful motor, with all-round...
£87.57
Shipping: Free
OnBuy
Unbranded 12V 80W Portable High Pressure Washer Spray Gun Electric Car Washer Cleaner Pump
Feature: The product is smaller a diving type washing machine on the market, truly achieve separation bucket machine, small volume does not occupy a...
£191.00
Shipping: £3.85
OnBuy
GreenZech 12V 80W Portable High Pressure Washer Spray Gun Electric Car Washer Cleaner Pump
Feature: Theproductissmalleradivingtypewashingmachineonthemarket,trulyachieveseparationbucketmachine,
£480.46
Shipping: Free
OnBuy
sukaudiz Portable Cordless Pressure Washer Max 45 Bar With 2 X 4000mah Batteries, 6 In 1
Portable Cordless Pressure Washer Max 45 Bar With 2 X 4000mah Batteries, 6 In 1, Garden & Patio > Garden Power Tools & Equipment > Pressure Washers
£109.99
Shipping: Free
eBay - yas4605
Housiwill Cordless Pressure Washer, 300W Portable Battery Pressure Washer with 2 Rechargeable Batteries Powered, 6-in-1 Nozzle Portable Cordless Power
Features ...
£80.06
Shipping: Free
OnBuy
Unbranded Multifunctional Car Organizer Car Seat Gap Filler Diaphragm Pump 12V High Pressure Water Pump Portable Pressure Washer With Good Atomization Effect Th OPC-PNGFCQZ-NEW
This multifunctional car organizer is not just for your vehicle-it's a complete high-pressure water pump system designed for performance and...
£92.81
Shipping: Free
OnBuy
3000PSI 2.6 GPM Portable Electric Pressure Washer High-Power Car Auto Cleaner OSHYHG930
3000PSI 2.6 GPM Portable Electric Pressure Washer High-Power Car Auto Cleaner, Garden & Patio > Garden Power Tools & Equipment > Pressure Washers
£54.20
Shipping: Free
eBay - firemotor2016
Unbranded 220V Portable Power For Pressure Washer Plunger Assembly Iron Copper Square Head Car Wash Accessories
Powerful 220V cleaning performance Delivers pressure water for cars, patios, and driveways, providing a strong water flow that quickly and...
£181.63
Shipping: Free
OnBuy
Unbranded Portable Car Pressure Washer, 12V Electric Washer Pump With Automatic Start-Stop, For Home, Car, Garden Cleaning Tasks
Designed for convenience and efficiency, our Portable Car Pressure Washer offers an effortless way to clean your car, home, or garden. With its...
£50.66
Shipping: Free
OnBuy
Electric Washer Pump 12V Portable Car High Pressure Washer Sprayer Power
Electric Washer Pump 12V Portable Car High Pressure Washer Sprayer Power, Garden & Patio > Garden Power Tools & Equipment > Pressure Washers
£37.65
Shipping: Free
eBay - fjheihsl
MAGIC SELECT Cordless Power Wash. Portable Pressure Washer with 2 Battery 48V. High Power Washer Machine 35 Bar/500PSI y 1500mAh/300W. With 3 Nozzles, 5M Hose and
Features ...
£74.97
Shipping: Free
OnBuy
TANBURO Portable Cordless High-Pressure Washer - with 2 Batteries & 6-in-1 Spray Nozzle
Portable Cordless High-Pressure Washer - with 2 Batteries & 6-in-1 Spray Nozzle, Garden & Patio > Garden Power Tools & Equipment > Pressure Washers
£31.99
Shipping: Free
eBay - greenpowerlog
TANBURO Portable Cordless High-Pressure Washer - with 2 Batteries & 6-in-1 Spray Nozzle
Portable Cordless High-Pressure Washer - with 2 Batteries & 6-in-1 Spray Nozzle, Garden & Patio > Garden Power Tools & Equipment > Pressure Washers
£31.99
Shipping: Free
eBay - bobobath-euro
Refine Search
Filters
Clear All
Category
✓Price
✓Brand
0Seller
0